
Domination area => Facesitting/Asslicking => Topic started by: squidmanheis on July 22, 2016, 10:13:40 pm

Title: Brutal Facesitting from Goddesses (Update)
Post by: squidmanheis on July 22, 2016, 10:13:40 pm
2 dommes 1 face

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/c/3Ipcb/2%20dommes%201%20face%20_cover.jpg) (http://pimpandhost.com/image/54912295-original.html)

File Name : 2 dommes 1 face
Runtime : 15min 5s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/c/3Ipcd/2%20dommes%201%20face%20_thumb_m.jpg) (http://pimpandhost.com/image/54912297-original.html)

Download Links:

2 dommes 1 face .rar (http://k2s.cc/file/ab921f41145f4)
Title: 2 dommes 1 face
Post by: squidmanheis on July 23, 2016, 03:58:56 pm
2 dommes 1 face

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/c/3Ipcb/2%20dommes%201%20face%20_cover.jpg) (http://pimpandhost.com/image/54912295-original.html)

File Name : 2 dommes 1 face
Runtime : 15min 5s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/c/3Ipcd/2%20dommes%201%20face%20_thumb_m.jpg) (http://pimpandhost.com/image/54912297-original.html)

Download Links:

2 dommes 1 face .rar (http://k2s.cc/file/ab921f41145f4)
Title: 15 Minutes Of Pure Hell
Post by: squidmanheis on July 23, 2016, 04:08:53 pm
15 Minutes Of Pure Hell

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/b/3Ipb6/15%20Minutes%20Of%20Pure%20Hell_cover.jpg) (http://pimpandhost.com/image/54912228-original.html)

File Name : 15 Minutes Of Pure Hell
Runtime : 15min 5s
File Size : 115 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/b/3Ipb7/15%20Minutes%20Of%20Pure%20Hell_thumb_m.jpg) (http://pimpandhost.com/image/54912229-original.html)

Download Links:

15 Minutes Of Pure Hell.rar (http://k2s.cc/file/de6cc99664c68)
Title: 411 95 pound girl abused
Post by: squidmanheis on July 23, 2016, 04:19:12 pm
411-95 pound girl abused

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/d/3Ipdc/411-95%20pound%20girl%20abused_cover.jpg) (http://pimpandhost.com/image/54912358-original.html)

File Name : 411-95 pound girl abused
Runtime : 18min 26s
File Size : 140 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/d/3Ipdd/411-95%20pound%20girl%20abused_thumb_m.jpg) (http://pimpandhost.com/image/54912359-original.html)

Download Links:

411-95 pound girl abused.rar (http://k2s.cc/file/8b8c5deaf3625)
Title: A permanent place to sit
Post by: squidmanheis on July 23, 2016, 04:29:18 pm
A permanent place to sit

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/d/3IpdS/A%20permanent%20place%20to%20sit_cover.jpg) (http://pimpandhost.com/image/54912400-original.html)

File Name : A permanent place to sit
Runtime : 15min 8s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/d/3IpdU/A%20permanent%20place%20to%20sit_thumb_m.jpg) (http://pimpandhost.com/image/54912402-original.html)

Download Links:

A permanent place to sit.rar (http://k2s.cc/file/a5f19422b5454)
Title: A relationship with her ass
Post by: squidmanheis on July 23, 2016, 04:38:56 pm
A relationship with her ass

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/e/3Ipes/A%20relationship%20with%20her%20ass_cover.jpg) (http://pimpandhost.com/image/54912436-original.html)

File Name : A relationship with her ass
Runtime : 18min 13s
File Size : 138 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/e/3Ipeu/A%20relationship%20with%20her%20ass_thumb_m.jpg) (http://pimpandhost.com/image/54912438-original.html)

Download Links:

A relationship with her ass.rar (http://k2s.cc/file/f7c427f66bfe8)
Title: After the cocktail party
Post by: squidmanheis on July 23, 2016, 04:48:56 pm
After the cocktail party

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/e/3IpeV/After%20the%20cocktail%20party_cover.jpg) (http://pimpandhost.com/image/54912465-original.html)

File Name : After the cocktail party
Runtime : 15min 45s
File Size : 119 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/e/3IpeW/After%20the%20cocktail%20party_thumb_m.jpg) (http://pimpandhost.com/image/54912466-original.html)

Download Links:

After the cocktail party.rar (http://k2s.cc/file/3759d9cfdcbb7)
Title: All up in that ass
Post by: squidmanheis on July 23, 2016, 04:58:59 pm
All up in that ass

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/f/3Ipf5/All%20up%20in%20that%20ass_cover.jpg) (http://pimpandhost.com/image/54912475-original.html)

File Name : All up in that ass
Runtime : 15min 11s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/f/3Ipf6/All%20up%20in%20that%20ass_thumb_m.jpg) (http://pimpandhost.com/image/54912476-original.html)

Download Links:

All up in that ass.rar (http://k2s.cc/file/68347b44ec46f)
Title: Aries sessions volume 3
Post by: squidmanheis on July 23, 2016, 05:08:51 pm
Aries sessions volume 3

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/i/3IpiR/Aries%20sessions%20volume%203_cover.jpg) (http://pimpandhost.com/image/54912709-original.html)

File Name : Aries sessions volume 3
Runtime : 14min 56s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/j/3Ipj2/Aries%20sessions%20volume%203_thumb_m.jpg) (http://pimpandhost.com/image/54912720-original.html)

Download Links:

Aries sessions volume 3.rar (http://k2s.cc/file/fd1566b33e921)
Title: Aries sessions volume 5
Post by: squidmanheis on July 23, 2016, 05:18:56 pm
Aries sessions volume 5

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/l/3Iplu/Aries%20sessions%20volume%205_cover.jpg) (http://pimpandhost.com/image/54912872-original.html)

File Name : Aries sessions volume 5
Runtime : 16min 1s
File Size : 157 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/l/3IplC/Aries%20sessions%20volume%205_thumb_m.jpg) (http://pimpandhost.com/image/54912880-original.html)

Download Links:

Aries sessions volume 5.rar (http://k2s.cc/file/71e37d76baea6)
Title: clip4sale Fat Proof And Milking A Pay Pig
Post by: squidmanheis on July 23, 2016, 05:29:00 pm
clip4sale - Fat Proof And Milking A Pay Pig

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/v/a/3Ivas/clip4sale%20-%20Fat%20Proof%20And%20Milking%20A%20Pay%20Pig_cover.jpg) (http://pimpandhost.com/image/54935252-original.html)

File Name : clip4sale - Fat Proof And Milking A Pay Pig
Runtime : 11min 42s
File Size : 263 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/v/a/3Ivaw/clip4sale%20-%20Fat%20Proof%20And%20Milking%20A%20Pay%20Pig_thumb_m.jpg) (http://pimpandhost.com/image/54935256-original.html)

Download Links:

clip4sale - Fat Proof And Milking A Pay Pig.rar (http://k2s.cc/file/f8c3f52f86cc1)
Title: Aries sessions volume 13
Post by: squidmanheis on September 08, 2016, 08:52:04 pm
Aries sessions volume 13

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/f/3IpfV/Aries%20sessions%20volume%2013%20_cover.jpg) (http://pimpandhost.com/image/54912527-original.html)

File Name : Aries sessions volume 13
Runtime : 11min 52s
File Size : 116 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/f/3IpfY/Aries%20sessions%20volume%2013%20_thumb_m.jpg) (http://pimpandhost.com/image/54912530-original.html)

Download Links:

Aries sessions volume 13 .rar (http://k2s.cc/file/8060a75f7cdba)
Title: Aries sessions volume 16
Post by: squidmanheis on September 09, 2016, 12:52:02 am
Aries sessions volume 16

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/g/3Ipgk/Aries%20sessions%20volume%2016_cover.jpg) (http://pimpandhost.com/image/54912552-original.html)

File Name : Aries sessions volume 16
Runtime : 13min 39s
File Size : 133 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/g/3Ipgl/Aries%20sessions%20volume%2016_thumb_m.jpg) (http://pimpandhost.com/image/54912553-original.html)

Download Links:

Aries sessions volume 16.rar (http://k2s.cc/file/1fc6c3942bcb4)
Title: Aries sessions volume 17
Post by: squidmanheis on September 09, 2016, 04:52:05 am
Aries sessions volume 17

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/h/3Iphh/Aries%20sessions%20volume%2017%20_cover.jpg) (http://pimpandhost.com/image/54912611-original.html)

File Name : Aries sessions volume 17
Runtime : 13min 28s
File Size : 131 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/h/3Iphm/Aries%20sessions%20volume%2017%20_thumb_m.jpg) (http://pimpandhost.com/image/54912616-original.html)

Download Links:

Aries sessions volume 17 .rar (http://k2s.cc/file/b05b30c31ea77)
Title: Aries sessions volume 9
Post by: squidmanheis on September 09, 2016, 08:51:59 am
Aries sessions volume 9

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/n/3IpnO/Aries%20sessions%20volume%209_cover.jpg) (http://pimpandhost.com/image/54913016-original.html)

File Name : Aries sessions volume 9
Runtime : 15min 31s
File Size : 152 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/n/3IpnU/Aries%20sessions%20volume%209_thumb_m.jpg) (http://pimpandhost.com/image/54913022-original.html)

Download Links:

Aries sessions volume 9.rar (http://k2s.cc/file/25269438ca5ba)
Title: Ass sniffing and smothering
Post by: squidmanheis on September 09, 2016, 12:52:00 pm
Ass sniffing and smothering

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/p/3Ipp0/Ass%20sniffing%20and%20smothering_cover.jpg) (http://pimpandhost.com/image/54913090-original.html)

File Name : Ass sniffing and smothering
Runtime : 15min 37s
File Size : 152 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/p/3Ipp1/Ass%20sniffing%20and%20smothering_thumb_m.jpg) (http://pimpandhost.com/image/54913091-original.html)

Download Links:

Ass sniffing and smothering.rar (http://k2s.cc/file/7a45955929d1a)
Title: Ass sniffing butt slut
Post by: squidmanheis on September 09, 2016, 04:52:00 pm
Ass sniffing butt slut

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/p/3Ippy/Ass%20sniffing%20butt%20slut_cover.jpg) (http://pimpandhost.com/image/54913124-original.html)

File Name : Ass sniffing butt slut
Runtime : 15min 15s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/p/3Ippz/Ass%20sniffing%20butt%20slut_thumb_m.jpg) (http://pimpandhost.com/image/54913125-original.html)

Download Links:

Ass sniffing butt slut.rar (http://k2s.cc/file/7a6b98e6406c8)
Title: Ass to face humiliation
Post by: squidmanheis on September 09, 2016, 08:52:03 pm
Ass to face humiliation

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/q/3Ipq6/Ass%20to%20face%20humiliation_cover.jpg) (http://pimpandhost.com/image/54913158-original.html)

File Name : Ass to face humiliation
Runtime : 14min 59s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/q/3Ipq9/Ass%20to%20face%20humiliation_thumb_m.jpg) (http://pimpandhost.com/image/54913161-original.html)

Download Links:

Ass to face humiliation.rar (http://k2s.cc/file/a6f3c4a815dfa)
Title: Austin smothers his face
Post by: squidmanheis on September 10, 2016, 12:52:00 am
Austin smothers his face

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/q/3IpqO/Austin%20smothers%20his%20face_cover.jpg) (http://pimpandhost.com/image/54913202-original.html)

File Name : Austin smothers his face
Runtime : 15min 39s
File Size : 153 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/q/3IpqU/Austin%20smothers%20his%20face_thumb_m.jpg) (http://pimpandhost.com/image/54913208-original.html)

Download Links:

Austin smothers his face.rar (http://k2s.cc/file/7758b90e41b15)
Title: Austins bubble butt smother
Post by: squidmanheis on September 10, 2016, 04:51:59 am
Austins bubble butt smother

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/r/3Ipre/Austins%20bubble%20butt%20smother_cover.jpg) (http://pimpandhost.com/image/54913228-original.html)

File Name : Austins bubble butt smother
Runtime : 15min 37s
File Size : 118 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/r/3Iprh/Austins%20bubble%20butt%20smother_thumb_m.jpg) (http://pimpandhost.com/image/54913231-original.html)

Download Links:

Austins bubble butt smother.rar (http://k2s.cc/file/827783872f769)
Title: Beaten, Facesit and Humiliated
Post by: squidmanheis on September 10, 2016, 08:52:51 am
Beaten, Facesit and Humiliated

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/r/3IprH/Beaten_%20Facesit%20and%20Humiliated_cover.jpg) (http://pimpandhost.com/image/54913257-original.html)

File Name : Beaten, Facesit and Humiliated
Runtime : 15min 6s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/r/3IprI/Beaten_%20Facesit%20and%20Humiliated_thumb_m.jpg) (http://pimpandhost.com/image/54913258-original.html)

Download Links:

Beaten, Facesit and Humiliated.rar (http://k2s.cc/file/b03a7dc2b8955)
Title: Beaten, Facesit and Humiliated
Post by: squidmanheis on September 10, 2016, 08:53:56 am
Beaten, Facesit and Humiliated

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/r/3IprH/Beaten_%20Facesit%20and%20Humiliated_cover.jpg) (http://pimpandhost.com/image/54913257-original.html)

File Name : Beaten, Facesit and Humiliated
Runtime : 15min 6s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/r/3IprI/Beaten_%20Facesit%20and%20Humiliated_thumb_m.jpg) (http://pimpandhost.com/image/54913258-original.html)

Download Links:

Beaten, Facesit and Humiliated.rar (http://k2s.cc/file/b03a7dc2b8955)
Title: Beaten, Facesit and Humiliated
Post by: squidmanheis on September 10, 2016, 08:55:08 am
Beaten, Facesit and Humiliated

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/r/3IprH/Beaten_%20Facesit%20and%20Humiliated_cover.jpg) (http://pimpandhost.com/image/54913257-original.html)

File Name : Beaten, Facesit and Humiliated
Runtime : 15min 6s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/r/3IprI/Beaten_%20Facesit%20and%20Humiliated_thumb_m.jpg) (http://pimpandhost.com/image/54913258-original.html)

Download Links:

Beaten, Facesit and Humiliated.rar (http://k2s.cc/file/b03a7dc2b8955)
Title: Being the seat of a young Cuban girl
Post by: squidmanheis on September 10, 2016, 12:53:32 pm
Being the seat of a young Cuban girl

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/s/3IpsV/Being%20the%20seat%20of%20a%20young%20Cuban%20girl_cover.jpg) (http://pimpandhost.com/image/54913333-original.html)

File Name : Being the seat of a young Cuban girl
Runtime : 15min 23s
File Size : 151 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/s/3IpsW/Being%20the%20seat%20of%20a%20young%20Cuban%20girl_thumb_m.jpg) (http://pimpandhost.com/image/54913334-original.html)

Download Links:

Being the seat of a young Cuban girl.rar (http://k2s.cc/file/4fb06fa067fee)
Title: Being the seat of a young Cuban girl
Post by: squidmanheis on September 10, 2016, 12:53:32 pm
Being the seat of a young Cuban girl

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/s/3IpsV/Being%20the%20seat%20of%20a%20young%20Cuban%20girl_cover.jpg) (http://pimpandhost.com/image/54913333-original.html)

File Name : Being the seat of a young Cuban girl
Runtime : 15min 23s
File Size : 151 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/s/3IpsW/Being%20the%20seat%20of%20a%20young%20Cuban%20girl_thumb_m.jpg) (http://pimpandhost.com/image/54913334-original.html)

Download Links:

Being the seat of a young Cuban girl.rar (http://k2s.cc/file/4fb06fa067fee)
Title: Being the seat of a young Cuban girl
Post by: squidmanheis on September 10, 2016, 12:53:57 pm
Being the seat of a young Cuban girl

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/s/3IpsV/Being%20the%20seat%20of%20a%20young%20Cuban%20girl_cover.jpg) (http://pimpandhost.com/image/54913333-original.html)

File Name : Being the seat of a young Cuban girl
Runtime : 15min 23s
File Size : 151 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/s/3IpsW/Being%20the%20seat%20of%20a%20young%20Cuban%20girl_thumb_m.jpg) (http://pimpandhost.com/image/54913334-original.html)

Download Links:

Being the seat of a young Cuban girl.rar (http://k2s.cc/file/4fb06fa067fee)
Title: Big ass on little face
Post by: squidmanheis on September 10, 2016, 04:52:25 pm
Big ass on little face

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/t/3IptS/Big%20ass%20on%20little%20face%20_cover.jpg) (http://pimpandhost.com/image/54913392-original.html)

File Name : Big ass on little face
Runtime : 17min 35s
File Size : 133 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/t/3IptV/Big%20ass%20on%20little%20face%20_thumb_m.jpg) (http://pimpandhost.com/image/54913395-original.html)

Download Links:

Big ass on little face .rar (http://k2s.cc/file/cc52f0bd5b5b1)
Title: Big ass on little face
Post by: squidmanheis on September 10, 2016, 04:53:23 pm
Big ass on little face

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/t/3IptS/Big%20ass%20on%20little%20face%20_cover.jpg) (http://pimpandhost.com/image/54913392-original.html)

File Name : Big ass on little face
Runtime : 17min 35s
File Size : 133 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/t/3IptV/Big%20ass%20on%20little%20face%20_thumb_m.jpg) (http://pimpandhost.com/image/54913395-original.html)

Download Links:

Big ass on little face .rar (http://k2s.cc/file/cc52f0bd5b5b1)
Title: Big ass on little face
Post by: squidmanheis on September 10, 2016, 04:53:57 pm
Big ass on little face

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/t/3IptS/Big%20ass%20on%20little%20face%20_cover.jpg) (http://pimpandhost.com/image/54913392-original.html)

File Name : Big ass on little face
Runtime : 17min 35s
File Size : 133 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/t/3IptV/Big%20ass%20on%20little%20face%20_thumb_m.jpg) (http://pimpandhost.com/image/54913395-original.html)

Download Links:

Big ass on little face .rar (http://k2s.cc/file/cc52f0bd5b5b1)
Title: Bound and Suffocated
Post by: squidmanheis on September 10, 2016, 08:52:57 pm
Bound and Suffocated

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/u/3Ipuw/Bound%20and%20Suffocated_cover.jpg) (http://pimpandhost.com/image/54913432-original.html)

File Name : Bound and Suffocated
Runtime : 18min 58s
File Size : 144 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/u/3Ipux/Bound%20and%20Suffocated_thumb_m.jpg) (http://pimpandhost.com/image/54913433-original.html)

Download Links:

Bound and Suffocated.rar (http://k2s.cc/file/cda4b7288ac0c)
Title: Bound and Suffocated
Post by: squidmanheis on September 10, 2016, 08:52:58 pm
Bound and Suffocated

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/u/3Ipuw/Bound%20and%20Suffocated_cover.jpg) (http://pimpandhost.com/image/54913432-original.html)

File Name : Bound and Suffocated
Runtime : 18min 58s
File Size : 144 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/u/3Ipux/Bound%20and%20Suffocated_thumb_m.jpg) (http://pimpandhost.com/image/54913433-original.html)

Download Links:

Bound and Suffocated.rar (http://k2s.cc/file/cda4b7288ac0c)
Title: Brittany becomes a facesitter
Post by: squidmanheis on September 11, 2016, 12:52:00 am
Brittany becomes a facesitter

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/v/3Ipva/Brittany%20becomes%20a%20facesitter_cover.jpg) (http://pimpandhost.com/image/54913472-original.html)

File Name : Brittany becomes a facesitter
Runtime : 15min 9s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/v/3Ipve/Brittany%20becomes%20a%20facesitter_thumb_m.jpg) (http://pimpandhost.com/image/54913476-original.html)

Download Links:

Brittany becomes a facesitter.rar (http://k2s.cc/file/f6295a1006b60)
Title: Brutalized
Post by: squidmanheis on September 11, 2016, 04:51:59 am

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/w/3Ipwa/Brutalized_cover.jpg) (http://pimpandhost.com/image/54913534-original.html)

File Name : Brutalized
Runtime : 14min 18s
File Size : 139 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/w/3Ipwd/Brutalized_thumb_m.jpg) (http://pimpandhost.com/image/54913537-original.html)

Download Links:

Brutalized.rar (http://k2s.cc/file/f1ea010deb056)
Title: Buried under Brookes big butt
Post by: squidmanheis on September 11, 2016, 08:52:06 am
Buried under Brookes big butt

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/x/3Ipx1/Buried%20under%20Brookes%20big%20butt_cover.jpg) (http://pimpandhost.com/image/54913587-original.html)

File Name : Buried under Brookes big butt
Runtime : 13min 20s
File Size : 130 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/x/3Ipx8/Buried%20under%20Brookes%20big%20butt_thumb_m.jpg) (http://pimpandhost.com/image/54913594-original.html)

Download Links:

Buried under Brookes big butt.rar (http://k2s.cc/file/0d558562c4169)
Title: Bury that tongue deep in my asshole
Post by: squidmanheis on September 11, 2016, 12:53:06 pm
Bury that tongue deep in my asshole

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/y/3Ipyu/Bury%20that%20tongue%20deep%20in%20my%20asshole_cover.jpg) (http://pimpandhost.com/image/54913678-original.html)

File Name : Bury that tongue deep in my asshole
Runtime : 15min 12s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/y/3IpyC/Bury%20that%20tongue%20deep%20in%20my%20asshole_thumb_m.jpg) (http://pimpandhost.com/image/54913686-original.html)

Download Links:

Bury that tongue deep in my asshole.rar (http://k2s.cc/file/86e7b460a34fa)
Title: Bury that tongue deep in my asshole
Post by: squidmanheis on September 11, 2016, 12:53:07 pm
Bury that tongue deep in my asshole

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/y/3Ipyu/Bury%20that%20tongue%20deep%20in%20my%20asshole_cover.jpg) (http://pimpandhost.com/image/54913678-original.html)

File Name : Bury that tongue deep in my asshole
Runtime : 15min 12s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/y/3IpyC/Bury%20that%20tongue%20deep%20in%20my%20asshole_thumb_m.jpg) (http://pimpandhost.com/image/54913686-original.html)

Download Links:

Bury that tongue deep in my asshole.rar (http://k2s.cc/file/86e7b460a34fa)
Title: Butrfli In Tight Pants
Post by: squidmanheis on September 11, 2016, 04:52:30 pm
Butrfli In Tight Pants

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/A/3IpA2/Butrfli%20In%20Tight%20Pants_cover.jpg) (http://pimpandhost.com/image/54913774-original.html)

File Name : Butrfli In Tight Pants
Runtime : 11min 17s
File Size : 118 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/A/3IpA4/Butrfli%20In%20Tight%20Pants_thumb_m.jpg) (http://pimpandhost.com/image/54913776-original.html)

Download Links:

Butrfli In Tight Pants.rar (http://k2s.cc/file/cc6109fdca3a8)
Title: Butrfli In Tight Pants
Post by: squidmanheis on September 11, 2016, 04:52:56 pm
Butrfli In Tight Pants

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/A/3IpA2/Butrfli%20In%20Tight%20Pants_cover.jpg) (http://pimpandhost.com/image/54913774-original.html)

File Name : Butrfli In Tight Pants
Runtime : 11min 17s
File Size : 118 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/A/3IpA4/Butrfli%20In%20Tight%20Pants_thumb_m.jpg) (http://pimpandhost.com/image/54913776-original.html)

Download Links:

Butrfli In Tight Pants.rar (http://k2s.cc/file/cc6109fdca3a8)
Title: Butt naked facesitting
Post by: squidmanheis on September 11, 2016, 08:51:54 pm
Butt naked facesitting

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/C/3IpCv/Butt%20naked%20facesitting_cover.jpg) (http://pimpandhost.com/image/54913927-original.html)

File Name : Butt naked facesitting
Runtime : 15min 17s
File Size : 150 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/C/3IpCy/Butt%20naked%20facesitting_thumb_m.jpg) (http://pimpandhost.com/image/54913930-original.html)

Download Links:

Butt naked facesitting.rar (http://k2s.cc/file/4d68e14a0d9d0)
Title: California beach girl smother
Post by: squidmanheis on September 12, 2016, 12:51:51 am
California beach girl smother

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/D/3IpDD/California%20beach%20girl%20smother_cover.jpg) (http://pimpandhost.com/image/54913997-original.html)

File Name : California beach girl smother
Runtime : 13min 2s
File Size : 127 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/D/3IpDH/California%20beach%20girl%20smother_thumb_m.jpg) (http://pimpandhost.com/image/54914001-original.html)

Download Links:

California beach girl smother.rar (http://k2s.cc/file/ae7b76863afe1)
Title: Cancel your plans youll be under my ass all day
Post by: squidmanheis on September 12, 2016, 04:51:53 am
Cancel your plans youll be under my ass all day

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/E/3IpER/Cancel%20your%20plans%20youll%20be%20under%20my%20ass%20all%20day_cover.jpg) (http://pimpandhost.com/image/54914073-original.html)

File Name : Cancel your plans youll be under my ass all day
Runtime : 15min 13s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/E/3IpEY/Cancel%20your%20plans%20youll%20be%20under%20my%20ass%20all%20day_thumb_m.jpg) (http://pimpandhost.com/image/54914080-original.html)

Download Links:

Cancel your plans youll be under my ass all day.rar (http://k2s.cc/file/f999a64962b44)
Title: Cheyenne in tight pants
Post by: squidmanheis on September 12, 2016, 08:51:48 am
Cheyenne in tight pants

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/H/3IpHD/Cheyenne%20in%20tight%20pants_cover.jpg) (http://pimpandhost.com/image/54914245-original.html)

File Name : Cheyenne in tight pants
Runtime : 12min 3s
File Size : 118 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/H/3IpHG/Cheyenne%20in%20tight%20pants_thumb_m.jpg) (http://pimpandhost.com/image/54914248-original.html)

Download Links:

Cheyenne in tight pants.rar (http://k2s.cc/file/ddca06fb383fa)
Title: Close ups of facesitting and ass worship
Post by: squidmanheis on September 12, 2016, 12:51:49 pm
Close ups of facesitting and ass worship

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/J/3IpJo/Close%20ups%20of%20facesitting%20and%20ass%20worship_cover.jpg) (http://pimpandhost.com/image/54914354-original.html)

File Name : Close ups of facesitting and ass worship
Runtime : 16min 5s
File Size : 157 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/J/3IpJt/Close%20ups%20of%20facesitting%20and%20ass%20worship_thumb_m.jpg) (http://pimpandhost.com/image/54914359-original.html)

Download Links:

Close ups of facesitting and ass worship.rar (http://k2s.cc/file/024bbaa4ff057)
Title: Constantly covered in pussy and ass
Post by: squidmanheis on September 12, 2016, 04:51:50 pm
Constantly covered in pussy and ass

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/K/3IpKW/Constantly%20covered%20in%20pussy%20and%20ass_cover.jpg) (http://pimpandhost.com/image/54914450-original.html)

File Name : Constantly covered in pussy and ass
Runtime : 14min 58s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/L/3IpL5/Constantly%20covered%20in%20pussy%20and%20ass_thumb_m.jpg) (http://pimpandhost.com/image/54914459-original.html)

Download Links:

Constantly covered in pussy and ass.rar (http://k2s.cc/file/9ddd7d2fce965)
Title: Cruel Eris has her way
Post by: squidmanheis on September 12, 2016, 08:51:56 pm
Cruel Eris has her way

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/N/3IpN1/Cruel%20Eris%20has%20her%20way_cover.jpg) (http://pimpandhost.com/image/54914579-original.html)

File Name : Cruel Eris has her way
Runtime : 15min 41s
File Size : 153 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/N/3IpNa/Cruel%20Eris%20has%20her%20way_thumb_m.jpg) (http://pimpandhost.com/image/54914588-original.html)

Download Links:

Cruel Eris has her way.rar (http://k2s.cc/file/9ee1fb95b3b72)
Title: Dirty sandy beach feet
Post by: squidmanheis on September 13, 2016, 12:51:44 am
Dirty sandy beach feet

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/Q/3IpQu/Dirty%20sandy%20beach%20feet_cover.jpg) (http://pimpandhost.com/image/54914794-original.html)

File Name : Dirty sandy beach feet
Runtime : 11min 21s
File Size : 111 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/Q/3IpQv/Dirty%20sandy%20beach%20feet_thumb_m.jpg) (http://pimpandhost.com/image/54914795-original.html)

Download Links:

Dirty sandy beach feet.rar (http://k2s.cc/file/d60afa7595020)
Title: Eris smothers and spits
Post by: squidmanheis on September 13, 2016, 04:51:46 am
Eris smothers and spits

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/S/3IpSi/Eris%20smothers%20and%20spits_cover.jpg) (http://pimpandhost.com/image/54914906-original.html)

File Name : Eris smothers and spits
Runtime : 14min 43s
File Size : 144 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/S/3IpSp/Eris%20smothers%20and%20spits_thumb_m.jpg) (http://pimpandhost.com/image/54914913-original.html)

Download Links:

Eris smothers and spits.rar (http://k2s.cc/file/614ffa661a4bb)
Title: Every inch of my crack is on your face
Post by: squidmanheis on September 13, 2016, 08:51:44 am
Every inch of my crack is on your face

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/W/3IpWw/Every%20inch%20of%20my%20crack%20is%20on%20your%20face_cover.jpg) (http://pimpandhost.com/image/54915168-original.html)

File Name : Every inch of my crack is on your face
Runtime : 15min 13s
File Size : 115 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/W/3IpWF/Every%20inch%20of%20my%20crack%20is%20on%20your%20face_thumb_m.jpg) (http://pimpandhost.com/image/54915177-original.html)

Download Links:

Every inch of my crack is on your face.rar (http://k2s.cc/file/2f5d614abb430)
Title: Face grinding by Heather
Post by: squidmanheis on September 13, 2016, 12:51:46 pm
Face grinding by Heather

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/Y/3IpYd/Face%20grinding%20by%20Heather_cover.jpg) (http://pimpandhost.com/image/54915273-original.html)

File Name : Face grinding by Heather
Runtime : 14min 4s
File Size : 137 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/p/Y/3IpYj/Face%20grinding%20by%20Heather_thumb_m.jpg) (http://pimpandhost.com/image/54915279-original.html)

Download Links:

Face grinding by Heather.rar (http://k2s.cc/file/72cd2cb66bfef)
Title: Facesat by female plumber
Post by: squidmanheis on September 13, 2016, 04:51:45 pm
Facesat by female plumber

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/0/3Iq0k/Facesat%20by%20female%20plumber_cover.jpg) (http://pimpandhost.com/image/54915404-original.html)

File Name : Facesat by female plumber
Runtime : 15min 19s
File Size : 116 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/0/3Iq0r/Facesat%20by%20female%20plumber_thumb_m.jpg) (http://pimpandhost.com/image/54915411-original.html)

Download Links:

Facesat by female plumber.rar (http://k2s.cc/file/ae423ed82e578)
Title: Felony orders me to worship her 510 19 year old friend
Post by: squidmanheis on September 13, 2016, 08:52:44 pm
Felony orders me to worship her 510 19 year old friend

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/3/3Iq3u/Felony%20orders%20me%20to%20worship%20her%20510%2019%20year%20old%20friend_cover.jpg) (http://pimpandhost.com/image/54915600-original.html)

File Name : Felony orders me to worship her 510 19 year old friend
Runtime : 15min 7s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/3/3Iq3A/Felony%20orders%20me%20to%20worship%20her%20510%2019%20year%20old%20friend_thumb_m.jpg) (http://pimpandhost.com/image/54915606-original.html)

Download Links:

Felony orders me to worship her 510 19 year old friend.rar (http://k2s.cc/file/c4eb2553c6020)
Title: Felony orders me to worship her friends ass finale
Post by: squidmanheis on September 14, 2016, 12:52:42 am
Felony orders me to worship her friends ass finale

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/4/3Iq4X/Felony%20orders%20me%20to%20worship%20her%20friends%20ass%20finale_cover.jpg) (http://pimpandhost.com/image/54915691-original.html)

File Name : Felony orders me to worship her friends ass finale
Runtime : 15min 26s
File Size : 151 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/5/3Iq52/Felony%20orders%20me%20to%20worship%20her%20friends%20ass%20finale_thumb_m.jpg) (http://pimpandhost.com/image/54915696-original.html)

Download Links:

Felony orders me to worship her friends ass finale.rar (http://k2s.cc/file/d5eff5dbebeaa)
Title: FemdomArmy slumber party 5
Post by: squidmanheis on September 14, 2016, 04:52:45 am
FemdomArmy slumber party 5

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/6/3Iq6i/FemdomArmy%20slumber%20party%205_cover.jpg) (http://pimpandhost.com/image/54915774-original.html)

File Name : FemdomArmy slumber party 5
Runtime : 14min 58s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/6/3Iq6p/FemdomArmy%20slumber%20party%205_thumb_m.jpg) (http://pimpandhost.com/image/54915781-original.html)

Download Links:

FemdomArmy slumber party 5.rar (http://k2s.cc/file/af19991faf262)
Title: FemdomArmy slumber party 6
Post by: squidmanheis on September 14, 2016, 08:52:39 am
FemdomArmy slumber party 6

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/8/3Iq8i/FemdomArmy%20slumber%20party%206_cover.jpg) (http://pimpandhost.com/image/54915898-original.html)

File Name : FemdomArmy slumber party 6
Runtime : 15min 5s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/8/3Iq8D/FemdomArmy%20slumber%20party%206_thumb_m.jpg) (http://pimpandhost.com/image/54915919-original.html)

Download Links:

FemdomArmy slumber party 6.rar (http://k2s.cc/file/a2dba035862bc)
Title: FemdomArmy slumber party 7
Post by: squidmanheis on September 14, 2016, 12:52:37 pm
FemdomArmy slumber party 7

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/a/3Iqaj/FemdomArmy%20slumber%20party%207%20_cover.jpg) (http://pimpandhost.com/image/54916023-original.html)

File Name : FemdomArmy slumber party 7
Runtime : 14min 28s
File Size : 141 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/a/3Iqak/FemdomArmy%20slumber%20party%207%20_thumb_m.jpg) (http://pimpandhost.com/image/54916024-original.html)

Download Links:

FemdomArmy slumber party 7 .rar (http://k2s.cc/file/78bc2e13f1910)
Title: FemdomArmy slumber party 8
Post by: squidmanheis on September 14, 2016, 04:52:36 pm
FemdomArmy slumber party 8

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/b/3Iqb7/FemdomArmy%20slumber%20party%208_cover.jpg) (http://pimpandhost.com/image/54916073-original.html)

File Name : FemdomArmy slumber party 8
Runtime : 15min 0s
File Size : 146 MB
File Type: wmv
Resolution : 640x480


Download Links:

FemdomArmy slumber party 8.rar (http://k2s.cc/file/a8fcadc18b14a)
Title: Gasping under all her weight
Post by: squidmanheis on September 14, 2016, 08:52:35 pm
Gasping under all her weight

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/d/3Iqdm/Gasping%20under%20all%20her%20weight_cover.jpg) (http://pimpandhost.com/image/54916212-original.html)

File Name : Gasping under all her weight
Runtime : 11min 44s
File Size : 115 MB
File Type: wmv
Resolution : 640x480


Download Links:

Gasping under all her weight.rar (http://k2s.cc/file/aef6aec67090c)
Title: Getting off on a complete strangers face
Post by: squidmanheis on September 15, 2016, 12:52:36 am
Getting off on a complete strangers face

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/f/3Iqf5/Getting%20off%20on%20a%20complete%20strangers%20face_cover.jpg) (http://pimpandhost.com/image/54916319-original.html)

File Name : Getting off on a complete strangers face
Runtime : 15min 52s
File Size : 155 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/f/3Iqf6/Getting%20off%20on%20a%20complete%20strangers%20face_thumb_m.jpg) (http://pimpandhost.com/image/54916320-original.html)

Download Links:

Getting off on a complete strangers face.rar (http://k2s.cc/file/8de84f179d245)
Title: Hailey Cummings face riding
Post by: squidmanheis on September 15, 2016, 04:52:34 am
Hailey Cummings face riding

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/g/3Iqgk/Hailey%20Cummings%20face%20riding_cover.jpg) (http://pimpandhost.com/image/54916396-original.html)

File Name : Hailey Cummings face riding
Runtime : 15min 18s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/g/3Iqgn/Hailey%20Cummings%20face%20riding_thumb_m.jpg) (http://pimpandhost.com/image/54916399-original.html)

Download Links:

Hailey Cummings face riding.rar (http://k2s.cc/file/728fb665ac4e9)
Title: Heather becomes a facesitter
Post by: squidmanheis on September 15, 2016, 08:52:30 am
Heather becomes a facesitter

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/h/3Iqhl/Heather%20becomes%20a%20facesitter_cover.jpg) (http://pimpandhost.com/image/54916459-original.html)

File Name : Heather becomes a facesitter
Runtime : 15min 16s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/h/3Iqhp/Heather%20becomes%20a%20facesitter_thumb_m.jpg) (http://pimpandhost.com/image/54916463-original.html)

Download Links:

Heather becomes a facesitter.rar (http://k2s.cc/file/1f9a69b3b7c2b)
Title: Her ass eats his face
Post by: squidmanheis on September 15, 2016, 12:52:40 pm
Her ass eats his face

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/i/3Iqix/Her%20ass%20eats%20his%20face%20_cover.jpg) (http://pimpandhost.com/image/54916533-original.html)

File Name : Her ass eats his face
Runtime : 12min 23s
File Size : 121 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/i/3Iqiy/Her%20ass%20eats%20his%20face%20_thumb_m.jpg) (http://pimpandhost.com/image/54916534-original.html)

Download Links:

Her ass eats his face .rar (http://k2s.cc/file/489749d1e97c2)
Title: Her big ass on my face
Post by: squidmanheis on September 15, 2016, 04:52:28 pm
Her big ass on my face

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/j/3Iqj8/Her%20big%20ass%20on%20my%20face_cover.jpg) (http://pimpandhost.com/image/54916570-original.html)

File Name : Her big ass on my face
Runtime : 11min 55s
File Size : 116 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/j/3Iqjg/Her%20big%20ass%20on%20my%20face_thumb_m.jpg) (http://pimpandhost.com/image/54916578-original.html)

Download Links:

Her big ass on my face.rar (http://k2s.cc/file/0b53322fa7fc4)
Title: Her fuck furniture
Post by: squidmanheis on September 15, 2016, 08:52:29 pm
Her fuck furniture

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/k/3Iqks/Her%20fuck%20furniture_cover.jpg) (http://pimpandhost.com/image/54916652-original.html)

File Name : Her fuck furniture
Runtime : 15min 6s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/k/3IqkA/Her%20fuck%20furniture_thumb_m.jpg) (http://pimpandhost.com/image/54916660-original.html)

Download Links:

Her fuck furniture.rar (http://k2s.cc/file/7e9e0873744c4)
Title: Her voluptuous body puts him in his place
Post by: squidmanheis on September 16, 2016, 12:52:29 am
Her voluptuous body puts him in his place

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/l/3IqlD/Her%20voluptuous%20body%20puts%20him%20in%20his%20place_cover.jpg) (http://pimpandhost.com/image/54916725-original.html)

File Name : Her voluptuous body puts him in his place
Runtime : 13min 16s
File Size : 129 MB
File Type: wmv
Resolution : 640x480


Download Links:

Her voluptuous body puts him in his place.rar (http://k2s.cc/file/dd56d1c946272)
Title: His face consumed by Nika
Post by: squidmanheis on September 16, 2016, 04:52:30 am
His face consumed by Nika

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/n/3Iqnn/His%20face%20consumed%20by%20Nika_cover.jpg) (http://pimpandhost.com/image/54916833-original.html)

File Name : His face consumed by Nika
Runtime : 11min 59s
File Size : 117 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/n/3Iqnz/His%20face%20consumed%20by%20Nika_thumb_m.jpg) (http://pimpandhost.com/image/54916845-original.html)

Download Links:

His face consumed by Nika.rar (http://k2s.cc/file/bfb42a77aa02a)
Title: His face is hamburger
Post by: squidmanheis on September 16, 2016, 08:52:27 am
His face is hamburger

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/p/3Iqps/His%20face%20is%20hamburger_cover.jpg) (http://pimpandhost.com/image/54916962-original.html)

File Name : His face is hamburger
Runtime : 15min 31s
File Size : 118 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/p/3IqpO/His%20face%20is%20hamburger_thumb_m.jpg) (http://pimpandhost.com/image/54916984-original.html)

Download Links:

His face is hamburger.rar (http://k2s.cc/file/09f609fb40707)
Title: His nose up Reese's ass
Post by: squidmanheis on September 16, 2016, 12:52:26 pm
His nose up Reese's ass

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/r/3Iqrc/His%20nose%20up%20Reese_s%20ass_cover.jpg) (http://pimpandhost.com/image/54917070-original.html)

File Name : His nose up Reese's ass
Runtime : 15min 11s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/r/3Iqrg/His%20nose%20up%20Reese_s%20ass_thumb_m.jpg) (http://pimpandhost.com/image/54917074-original.html)

Download Links:

His nose up Reese's ass.rar (http://k2s.cc/file/1b2c4e659cc72)
Title: Hot piece of ass sits square on his face
Post by: squidmanheis on September 16, 2016, 04:52:26 pm
Hot piece of ass sits square on his face


File Name : Hot piece of ass sits square on his face
Runtime : 15min 0s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/s/3Iqs7/Hot%20piece%20of%20ass%20sits%20square%20on%20his%20face_thumb_m.jpg) (http://pimpandhost.com/image/54917127-original.html)

Download Links:

Hot piece of ass sits square on his face.rar (http://k2s.cc/file/588ef5189cb2d)
Title: Humiliated White Boy
Post by: squidmanheis on September 16, 2016, 08:52:24 pm
Humiliated White Boy

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/t/3IqtZ/Humiliated%20White%20Boy_cover.jpg) (http://pimpandhost.com/image/54917243-original.html)

File Name : Humiliated White Boy
Runtime : 19min 35s
File Size : 148 MB
File Type: wmv
Resolution : 640x360


Download Links:

Humiliated White Boy.rar (http://k2s.cc/file/b0b60f91a6081)
Title: Humiliating session at Deviant Domain
Post by: squidmanheis on October 06, 2016, 05:36:45 pm
Humiliating session at Deviant Domain


File Name : Humiliating session at Deviant Domain
Runtime : 15min 21s
File Size : 150 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/x/3Iqx7/Humiliating%20session%20at%20Deviant%20Domain_thumb_m.jpg) (http://pimpandhost.com/image/54917437-original.html)

Download Links:

Humiliating session at Deviant Domain.rar (http://k2s.cc/file/e3a3a0b576180)
Title: I can breathe so who cares
Post by: squidmanheis on October 06, 2016, 09:01:47 pm
I can breathe so who cares

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/z/3Iqzs/I%20can%20breathe%20so%20who%20cares_cover.jpg) (http://pimpandhost.com/image/54917582-original.html)

File Name : I can breathe so who cares
Runtime : 14min 56s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/z/3Iqzu/I%20can%20breathe%20so%20who%20cares_thumb_m.jpg) (http://pimpandhost.com/image/54917584-original.html)

Download Links:

I can breathe so who cares.rar (http://k2s.cc/file/1d31e21063148)
Title: In between her cheeks
Post by: squidmanheis on October 07, 2016, 12:26:47 am
In between her cheeks

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/C/3IqC9/In%20between%20her%20cheeks_cover.jpg) (http://pimpandhost.com/image/54917749-original.html)

File Name : In between her cheeks
Runtime : 13min 28s
File Size : 131 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/C/3IqCr/In%20between%20her%20cheeks_thumb_m.jpg) (http://pimpandhost.com/image/54917767-original.html)

Download Links:

In between her cheeks.rar (http://k2s.cc/file/cc3e0140cc6c2)
Title: Kasey worships Nadia
Post by: squidmanheis on October 07, 2016, 03:51:43 am
Kasey worships Nadia

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/G/3IqGZ/Kasey%20worships%20Nadia_cover.jpg) (http://pimpandhost.com/image/54918049-original.html)

File Name : Kasey worships Nadia
Runtime : 14min 59s
File Size : 113 MB
File Type: wmv
Resolution : 640x360


Download Links:

Kasey worships Nadia.rar (http://k2s.cc/file/ce64c6afcfddf)
Title: Kidnapped and smothered by stalker
Post by: squidmanheis on October 07, 2016, 07:16:45 am
Kidnapped and smothered by stalker

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/L/3IqLM/Kidnapped%20and%20smothered%20by%20stalker_cover.jpg) (http://pimpandhost.com/image/54918346-original.html)

File Name : Kidnapped and smothered by stalker
Runtime : 18min 24s
File Size : 139 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/L/3IqLQ/Kidnapped%20and%20smothered%20by%20stalker_thumb_m.jpg) (http://pimpandhost.com/image/54918350-original.html)

Download Links:

Kidnapped and smothered by stalker.rar (http://k2s.cc/file/b6e70cff57be6)
Title: Kinky redheads ass slave 1
Post by: squidmanheis on October 07, 2016, 10:41:41 am
Kinky redheads ass slave 1

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/M/3IqMJ/Kinky%20redheads%20ass%20slave%201_cover.jpg) (http://pimpandhost.com/image/54918405-original.html)

File Name : Kinky redheads ass slave 1
Runtime : 14min 3s
File Size : 137 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/M/3IqMS/Kinky%20redheads%20ass%20slave%201_thumb_m.jpg) (http://pimpandhost.com/image/54918414-original.html)

Download Links:

Kinky redheads ass slave 1.rar (http://k2s.cc/file/a55c5bda1c1ca)
Title: Kinky redheads ass slave 3
Post by: squidmanheis on October 07, 2016, 02:06:45 pm
Kinky redheads ass slave 3

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/O/3IqOy/Kinky%20redheads%20ass%20slave%203_cover.jpg) (http://pimpandhost.com/image/54918518-original.html)

File Name : Kinky redheads ass slave 3
Runtime : 14min 18s
File Size : 140 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/O/3IqOE/Kinky%20redheads%20ass%20slave%203_thumb_m.jpg) (http://pimpandhost.com/image/54918524-original.html)

Download Links:

Kinky redheads ass slave 3.rar (http://k2s.cc/file/7824776857527)
Title: Late night session
Post by: squidmanheis on October 07, 2016, 05:31:41 pm
Late night session

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/R/3IqRu/Late%20night%20session_cover.jpg) (http://pimpandhost.com/image/54918700-original.html)

File Name : Late night session
Runtime : 15min 29s
File Size : 151 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/R/3IqRE/Late%20night%20session_thumb_m.jpg) (http://pimpandhost.com/image/54918710-original.html)

Download Links:

Late night session.rar (http://k2s.cc/file/503a37885ea04)
Title: Let me smother you
Post by: squidmanheis on October 07, 2016, 08:56:45 pm
Let me smother you

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/S/3IqSG/Let%20me%20smother%20you_cover.jpg) (http://pimpandhost.com/image/54918774-original.html)

File Name : Let me smother you
Runtime : 14min 41s
File Size : 144 MB
File Type: wmv
Resolution : 640x480


Download Links:

Let me smother you.rar (http://k2s.cc/file/c0190766b6616)
Title: Lets spend the day together
Post by: squidmanheis on October 08, 2016, 12:21:42 am
Lets spend the day together

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/U/3IqU4/Lets%20spend%20the%20day%20together_cover.jpg) (http://pimpandhost.com/image/54918860-original.html)

File Name : Lets spend the day together
Runtime : 15min 23s
File Size : 116 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/U/3IqUg/Lets%20spend%20the%20day%20together_thumb_m.jpg) (http://pimpandhost.com/image/54918872-original.html)

Download Links:

Lets spend the day together.rar (http://k2s.cc/file/3abbcdf10bcb3)
Title: Lexxus the face crusher 2
Post by: squidmanheis on October 08, 2016, 07:11:40 am
Lexxus the face crusher 2

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/X/3IqX5/Lexxus%20the%20face%20crusher%202_cover.jpg) (http://pimpandhost.com/image/54919047-original.html)

File Name : Lexxus the face crusher 2
Runtime : 14min 30s
File Size : 142 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/X/3IqXc/Lexxus%20the%20face%20crusher%202_thumb_m.jpg) (http://pimpandhost.com/image/54919054-original.html)

Download Links:

Lexxus the face crusher 2.rar (http://k2s.cc/file/07f095576c92d)
Title: Lexxus the face crusher Finale
Post by: squidmanheis on October 08, 2016, 10:36:42 am
Lexxus the face crusher Finale

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/Y/3IqYe/Lexxus%20the%20face%20crusher%20Finale_cover.jpg) (http://pimpandhost.com/image/54919118-original.html)

File Name : Lexxus the face crusher Finale
Runtime : 15min 9s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/Y/3IqYh/Lexxus%20the%20face%20crusher%20Finale_thumb_m.jpg) (http://pimpandhost.com/image/54919121-original.html)

Download Links:

Lexxus the face crusher Finale.rar (http://k2s.cc/file/bdfe5b75bf351)
Title: Lost in Haileys ass
Post by: squidmanheis on October 08, 2016, 02:01:39 pm
Lost in Haileys ass

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/Z/3IqZv/Lost%20in%20Haileys%20ass_cover.jpg) (http://pimpandhost.com/image/54919197-original.html)

File Name : Lost in Haileys ass
Runtime : 15min 15s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/Z/3IqZy/Lost%20in%20Haileys%20ass_thumb_m.jpg) (http://pimpandhost.com/image/54919200-original.html)

Download Links:

Lost in Haileys ass.rar (http://k2s.cc/file/af5d16fb2d3b6)
Title: Making out with their assholes
Post by: squidmanheis on October 08, 2016, 05:26:39 pm
Making out with their assholes


File Name : Making out with their assholes
Runtime : 14min 20s
File Size : 140 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/1/3Ir1T/Making%20out%20with%20their%20assholes%20_thumb_m.jpg) (http://pimpandhost.com/image/54919345-original.html)

Download Links:

Making out with their assholes .rar (http://k2s.cc/file/6a22af1c062de)
Title: Mandys monster ass 2
Post by: squidmanheis on October 08, 2016, 08:51:37 pm
Mandys monster ass 2

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/3/3Ir3m/Mandys%20monster%20ass%202_cover.jpg) (http://pimpandhost.com/image/54919436-original.html)

File Name : Mandys monster ass 2
Runtime : 14min 47s
File Size : 144 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/3/3Ir3u/Mandys%20monster%20ass%202_thumb_m.jpg) (http://pimpandhost.com/image/54919444-original.html)

Download Links:

Mandys monster ass 2.rar (http://k2s.cc/file/7057f47a62465)
Title: Mandys monster ass 3
Post by: squidmanheis on October 09, 2016, 12:16:38 am
Mandys monster ass 3

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/5/3Ir5j/Mandys%20monster%20ass%203_cover.jpg) (http://pimpandhost.com/image/54919557-original.html)

File Name : Mandys monster ass 3
Runtime : 14min 59s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/5/3Ir5q/Mandys%20monster%20ass%203_thumb_m.jpg) (http://pimpandhost.com/image/54919564-original.html)

Download Links:

Mandys monster ass 3.rar (http://k2s.cc/file/83bd694ae10c1)
Title: Mandys monster ass
Post by: squidmanheis on October 09, 2016, 03:41:39 am
Mandys monster ass

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/6/3Ir6S/Mandys%20monster%20ass_cover.jpg) (http://pimpandhost.com/image/54919654-original.html)

File Name : Mandys monster ass
Runtime : 15min 33s
File Size : 151 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/7/3Ir7e/Mandys%20monster%20ass_thumb_m.jpg) (http://pimpandhost.com/image/54919676-original.html)

Download Links:

Mandys monster ass.rar (http://k2s.cc/file/ce8be442bc049)
Title: Mean Girls Need To Cum Too
Post by: squidmanheis on October 09, 2016, 07:06:34 am
Mean Girls Need To Cum Too

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/8/3Ir8C/Mean%20Girls%20Need%20To%20Cum%20Too_cover.jpg) (http://pimpandhost.com/image/54919762-original.html)

File Name : Mean Girls Need To Cum Too
Runtime : 14min 42s
File Size : 112 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/8/3Ir8J/Mean%20Girls%20Need%20To%20Cum%20Too_thumb_m.jpg) (http://pimpandhost.com/image/54919769-original.html)

Download Links:

Mean Girls Need To Cum Too.rar (http://k2s.cc/file/0d191e183694d)
Title: Meeting Madame Butrfli
Post by: squidmanheis on October 09, 2016, 10:31:34 am
Meeting Madame Butrfli

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/9/3Ir9y/Meeting%20Madame%20Butrfli_cover.jpg) (http://pimpandhost.com/image/54919820-original.html)

File Name : Meeting Madame Butrfli
Runtime : 15min 31s
File Size : 117 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/9/3Ir9C/Meeting%20Madame%20Butrfli_thumb_m.jpg) (http://pimpandhost.com/image/54919824-original.html)

Download Links:

Meeting Madame Butrfli.rar (http://k2s.cc/file/54c31492bc604)
Title: Megan in tight pants
Post by: squidmanheis on October 09, 2016, 01:56:33 pm
Megan in tight pants

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/b/3Irbz/Megan%20in%20tight%20pants_cover.jpg) (http://pimpandhost.com/image/54919945-original.html)

File Name : Megan in tight pants
Runtime : 12min 1s
File Size : 117 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/b/3IrbA/Megan%20in%20tight%20pants_thumb_m.jpg) (http://pimpandhost.com/image/54919946-original.html)

Download Links:

Megan in tight pants.rar (http://k2s.cc/file/9d29128e58a24)
Title: Mistreated Chair
Post by: squidmanheis on October 09, 2016, 05:21:33 pm
Mistreated Chair

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/c/3IrcI/Mistreated%20Chair_cover.jpg) (http://pimpandhost.com/image/54920016-original.html)

File Name : Mistreated Chair
Runtime : 15min 0s
File Size : 113 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/c/3IrcS/Mistreated%20Chair_thumb_m.jpg) (http://pimpandhost.com/image/54920026-original.html)

Download Links:

Mistreated Chair.rar (http://k2s.cc/file/8d49a2b0c7823)
Title: Mistress Lanai hardcore smothering 2
Post by: squidmanheis on October 09, 2016, 08:46:39 pm
Mistress Lanai hardcore smothering 2

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/e/3Iren/Mistress%20Lanai%20hardcore%20smothering%202_cover.jpg) (http://pimpandhost.com/image/54920119-original.html)

File Name : Mistress Lanai hardcore smothering 2
Runtime : 15min 6s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/e/3Irey/Mistress%20Lanai%20hardcore%20smothering%202_thumb_m.jpg) (http://pimpandhost.com/image/54920130-original.html)

Download Links:

Mistress Lanai hardcore smothering 2.rar (http://k2s.cc/file/2f965c83efd64)
Title: Mistress Lanai hardcore smothering 3
Post by: squidmanheis on October 10, 2016, 12:11:32 am
Mistress Lanai hardcore smothering 3

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/i/3Iriq/Mistress%20Lanai%20hardcore%20smothering%203_cover.jpg) (http://pimpandhost.com/image/54920370-original.html)

File Name : Mistress Lanai hardcore smothering 3
Runtime : 13min 28s
File Size : 132 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/i/3Iriy/Mistress%20Lanai%20hardcore%20smothering%203_thumb_m.jpg) (http://pimpandhost.com/image/54920378-original.html)

Download Links:

Mistress Lanai hardcore smothering 3.rar (http://k2s.cc/file/b871a6e6c96e1)
Title: Mistress Sixxs ass slut
Post by: squidmanheis on October 10, 2016, 03:36:31 am
Mistress Sixxs ass slut

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/l/3Irlu/Mistress%20Sixxs%20ass%20slut_cover.jpg) (http://pimpandhost.com/image/54920560-original.html)

File Name : Mistress Sixxs ass slut
Runtime : 14min 19s
File Size : 139 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/l/3IrlA/Mistress%20Sixxs%20ass%20slut_thumb_m.jpg) (http://pimpandhost.com/image/54920566-original.html)

Download Links:

Mistress Sixxs ass slut.rar (http://k2s.cc/file/a83938a880504)
Title: More of Felony facesitting and ass worship
Post by: squidmanheis on October 10, 2016, 07:01:15 am
More of Felony facesitting and ass worship


File Name : More of Felony facesitting and ass worship
Runtime : 15min 0s
File Size : 147 MB
File Type: wmv
Resolution : 640x480


Download Links:

More of Felony facesitting and ass worship.rar (http://k2s.cc/file/85da5bb58078a)
Title: My clit in your mouth and ass on your face
Post by: squidmanheis on October 10, 2016, 10:26:28 am
My clit in your mouth and ass on your face

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/q/3Irqj/My%20clit%20in%20your%20mouth%20and%20ass%20on%20your%20face_cover.jpg) (http://pimpandhost.com/image/54920859-original.html)

File Name : My clit in your mouth and ass on your face
Runtime : 15min 0s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/q/3Irqk/My%20clit%20in%20your%20mouth%20and%20ass%20on%20your%20face_thumb_m.jpg) (http://pimpandhost.com/image/54920860-original.html)

Download Links:

My clit in your mouth and ass on your face.rar (http://k2s.cc/file/74ce08a310b16)
Title: Not in The Mood to Give Him Air
Post by: squidmanheis on October 10, 2016, 01:51:28 pm
Not in The Mood to Give Him Air

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/r/3Irrg/Not%20in%20The%20Mood%20to%20Give%20Him%20Air_cover.jpg) (http://pimpandhost.com/image/54920918-original.html)

File Name : Not in The Mood to Give Him Air
Runtime : 14min 32s
File Size : 142 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/r/3Irrh/Not%20in%20The%20Mood%20to%20Give%20Him%20Air_thumb_m.jpg) (http://pimpandhost.com/image/54920919-original.html)

Download Links:

Not in The Mood to Give Him Air.rar (http://k2s.cc/file/9db2a90990df0)
Title: Objective Suffocation
Post by: squidmanheis on October 10, 2016, 05:16:29 pm
Objective Suffocation

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/s/3IrsG/Objective%20Suffocation_cover.jpg) (http://pimpandhost.com/image/54921006-original.html)

File Name : Objective Suffocation
Runtime : 15min 39s
File Size : 119 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/s/3IrsL/Objective%20Suffocation_thumb_m.jpg) (http://pimpandhost.com/image/54921011-original.html)

Download Links:

Objective Suffocation.rar (http://k2s.cc/file/1cf971b25b610)
Title: Overbearing wife face abuse and pussy eating
Post by: squidmanheis on October 10, 2016, 08:41:26 pm
Overbearing wife face abuse and pussy eating

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/t/3Irtu/Overbearing%20wife%20face%20abuse%20and%20pussy%20eating_cover.jpg) (http://pimpandhost.com/image/54921056-original.html)

File Name : Overbearing wife face abuse and pussy eating
Runtime : 16min 8s
File Size : 158 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/t/3IrtB/Overbearing%20wife%20face%20abuse%20and%20pussy%20eating_thumb_m.jpg) (http://pimpandhost.com/image/54921063-original.html)

Download Links:

Overbearing wife face abuse and pussy eating.rar (http://k2s.cc/file/dd53718204347)
Title: Overbearing wife no more phone calls
Post by: squidmanheis on October 11, 2016, 12:06:25 am
Overbearing wife no more phone calls

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/v/3Irv1/Overbearing%20wife%20no%20more%20phone%20calls_cover.jpg) (http://pimpandhost.com/image/54921151-original.html)

File Name : Overbearing wife no more phone calls
Runtime : 13min 47s
File Size : 134 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/v/3Irv3/Overbearing%20wife%20no%20more%20phone%20calls_thumb_m.jpg) (http://pimpandhost.com/image/54921153-original.html)

Download Links:

Overbearing wife no more phone calls.rar (http://k2s.cc/file/33b1bf99f8004)
Title: Overdose on pussy and ass
Post by: squidmanheis on October 11, 2016, 03:31:28 am
Overdose on pussy and ass

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/v/3IrvU/Overdose%20on%20pussy%20and%20ass%20_cover.jpg) (http://pimpandhost.com/image/54921206-original.html)

File Name : Overdose on pussy and ass
Runtime : 15min 4s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/w/3Irw0/Overdose%20on%20pussy%20and%20ass%20_thumb_m.jpg) (http://pimpandhost.com/image/54921212-original.html)

Download Links:

Overdose on pussy and ass .rar (http://k2s.cc/file/761c398ecdf15)
Title: Owned by Jada
Post by: squidmanheis on October 11, 2016, 06:56:27 am
Owned by Jada

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/y/3IryT/Owned%20by%20Jada_cover.jpg) (http://pimpandhost.com/image/54921391-original.html)

File Name : Owned by Jada
Runtime : 15min 11s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/z/3Irz1/Owned%20by%20Jada_thumb_m.jpg) (http://pimpandhost.com/image/54921399-original.html)

Download Links:

Owned by Jada.rar (http://k2s.cc/file/a1753a893d40f)
Title: Playing with her vibrator while smothering him
Post by: squidmanheis on October 11, 2016, 10:21:26 am
Playing with her vibrator while smothering him

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/A/3IrAx/Playing%20with%20her%20vibrator%20while%20smothering%20him_cover.jpg) (http://pimpandhost.com/image/54921493-original.html)

File Name : Playing with her vibrator while smothering him
Runtime : 14min 38s
File Size : 143 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/A/3IrAA/Playing%20with%20her%20vibrator%20while%20smothering%20him_thumb_m.jpg) (http://pimpandhost.com/image/54921496-original.html)

Download Links:

Playing with her vibrator while smothering him.rar (http://k2s.cc/file/b4809e173b344)
Title: Pleasing his mistress
Post by: squidmanheis on October 11, 2016, 01:46:25 pm
Pleasing his mistress

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/C/3IrC8/Pleasing%20his%20mistress_cover.jpg) (http://pimpandhost.com/image/54921592-original.html)

File Name : Pleasing his mistress
Runtime : 15min 5s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/C/3IrC9/Pleasing%20his%20mistress_thumb_m.jpg) (http://pimpandhost.com/image/54921593-original.html)

Download Links:

Pleasing his mistress.rar (http://k2s.cc/file/a988a886bfc80)
Title: Property of Krissy Lynns pussy and ass
Post by: squidmanheis on October 11, 2016, 05:11:26 pm
Property of Krissy Lynns pussy and ass

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/E/3IrEs/Property%20of%20Krissy%20Lynns%20pussy%20and%20ass_cover.jpg) (http://pimpandhost.com/image/54921736-original.html)

File Name : Property of Krissy Lynns pussy and ass
Runtime : 12min 41s
File Size : 124 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/E/3IrEt/Property%20of%20Krissy%20Lynns%20pussy%20and%20ass_thumb_m.jpg) (http://pimpandhost.com/image/54921737-original.html)

Download Links:

Property of Krissy Lynns pussy and ass.rar (http://k2s.cc/file/eee5fb5abc731)
Title: Pussy juice on your face
Post by: squidmanheis on October 11, 2016, 08:36:30 pm
Pussy juice on your face

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/F/3IrF9/Pussy%20juice%20on%20your%20face_cover.jpg) (http://pimpandhost.com/image/54921779-original.html)

File Name : Pussy juice on your face
Runtime : 12min 5s
File Size : 118 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/F/3IrFb/Pussy%20juice%20on%20your%20face_thumb_m.jpg) (http://pimpandhost.com/image/54921781-original.html)

Download Links:

Pussy juice on your face.rar (http://k2s.cc/file/725745442f95c)
Title: Queened by The Queen
Post by: squidmanheis on October 12, 2016, 12:01:24 am
Queened by The Queen

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/F/3IrFT/Queened%20by%20The%20Queen_cover.jpg) (http://pimpandhost.com/image/54921825-original.html)

File Name : Queened by The Queen
Runtime : 15min 0s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/F/3IrFU/Queened%20by%20The%20Queen_thumb_m.jpg) (http://pimpandhost.com/image/54921826-original.html)

Download Links:

Queened by The Queen.rar (http://k2s.cc/file/7f7d5fdb1d112)
Title: Reese and Cheyenne team up
Post by: squidmanheis on October 12, 2016, 03:26:25 am
Reese and Cheyenne team up

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/H/3IrHD/Reese%20and%20Cheyenne%20team%20up_cover.jpg) (http://pimpandhost.com/image/54921933-original.html)

File Name : Reese and Cheyenne team up
Runtime : 15min 4s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/H/3IrHF/Reese%20and%20Cheyenne%20team%20up_thumb_m.jpg) (http://pimpandhost.com/image/54921935-original.html)

Download Links:

Reese and Cheyenne team up.rar (http://k2s.cc/file/1e60fb3a5aaf5)
Title: Reese and Tangents foot whore
Post by: squidmanheis on October 12, 2016, 06:51:23 am
Reese and Tangents foot whore

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/I/3IrIs/Reese%20and%20Tangents%20foot%20whore_cover.jpg) (http://pimpandhost.com/image/54921984-original.html)

File Name : Reese and Tangents foot whore
Runtime : 12min 13s
File Size : 119 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/I/3IrIv/Reese%20and%20Tangents%20foot%20whore_thumb_m.jpg) (http://pimpandhost.com/image/54921987-original.html)

Download Links:

Reese and Tangents foot whore.rar (http://k2s.cc/file/e266a979beec5)
Title: Reese fucks him up
Post by: squidmanheis on October 12, 2016, 10:16:19 am
Reese fucks him up

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/J/3IrJJ/Reese%20fucks%20him%20up%20_cover.jpg) (http://pimpandhost.com/image/54922063-original.html)

File Name : Reese fucks him up
Runtime : 15min 22s
File Size : 150 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/J/3IrJL/Reese%20fucks%20him%20up%20_thumb_m.jpg) (http://pimpandhost.com/image/54922065-original.html)

Download Links:

Reese fucks him up .rar (http://k2s.cc/file/9cb106d17a512)
Title: Reese Goes Beserk
Post by: squidmanheis on October 12, 2016, 01:41:22 pm
Reese Goes Beserk

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/K/3IrKX/Reese%20Goes%20Beserk_cover.jpg) (http://pimpandhost.com/image/54922139-original.html)

File Name : Reese Goes Beserk
Runtime : 14min 59s
File Size : 114 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/K/3IrKY/Reese%20Goes%20Beserk_thumb_m.jpg) (http://pimpandhost.com/image/54922140-original.html)

Download Links:

Reese Goes Beserk.rar (http://k2s.cc/file/e2b85611791f0)
Title: Reese on the smotherbox
Post by: squidmanheis on October 12, 2016, 05:06:22 pm
Reese on the smotherbox

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/L/3IrLF/Reese%20on%20the%20smotherbox_cover.jpg) (http://pimpandhost.com/image/54922183-original.html)

File Name : Reese on the smotherbox
Runtime : 15min 12s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/L/3IrLG/Reese%20on%20the%20smotherbox_thumb_m.jpg) (http://pimpandhost.com/image/54922184-original.html)

Download Links:

Reese on the smotherbox.rar (http://k2s.cc/file/ae28f543d2f82)
Title: Reese shares her lunch
Post by: squidmanheis on October 12, 2016, 08:32:21 pm
Reese shares her lunch

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/N/3IrNE/Reese%20shares%20her%20lunch_cover.jpg) (http://pimpandhost.com/image/54922306-original.html)

File Name : Reese shares her lunch
Runtime : 15min 6s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/N/3IrNH/Reese%20shares%20her%20lunch_thumb_m.jpg) (http://pimpandhost.com/image/54922309-original.html)

Download Links:

Reese shares her lunch.rar (http://k2s.cc/file/12dcd1331b6e7)
Title: Resisting Is Useless
Post by: squidmanheis on October 12, 2016, 11:57:19 pm
Resisting Is Useless

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/P/3IrPk/Resisting%20Is%20Useless_cover.jpg) (http://pimpandhost.com/image/54922410-original.html)

File Name : Resisting Is Useless
Runtime : 14min 56s
File Size : 114 MB
File Type: wmv
Resolution : 640x360


Download Links:

Resisting Is Useless.rar (http://k2s.cc/file/dbfb36555d934)
Title: Roughed up and forced to eat their assholes
Post by: squidmanheis on October 13, 2016, 03:22:19 am
Roughed up and forced to eat their assholes

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/Q/3IrQt/Roughed%20up%20and%20forced%20to%20eat%20their%20assholes_cover.jpg) (http://pimpandhost.com/image/54922481-original.html)

File Name : Roughed up and forced to eat their assholes
Runtime : 15min 46s
File Size : 154 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/Q/3IrQu/Roughed%20up%20and%20forced%20to%20eat%20their%20assholes_thumb_m.jpg) (http://pimpandhost.com/image/54922482-original.html)

Download Links:

Roughed up and forced to eat their assholes.rar (http://k2s.cc/file/7f530b65a0b33)
Title: Roxie becomes a facesitter
Post by: squidmanheis on October 13, 2016, 06:48:26 am
Roxie becomes a facesitter

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/Q/3IrQT/Roxie%20becomes%20a%20facesitter_cover.jpg) (http://pimpandhost.com/image/54922507-original.html)

File Name : Roxie becomes a facesitter
Runtime : 15min 10s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/Q/3IrQU/Roxie%20becomes%20a%20facesitter_thumb_m.jpg) (http://pimpandhost.com/image/54922508-original.html)

Download Links:

Roxie becomes a facesitter.rar (http://k2s.cc/file/fba0017ee1be8)
Title: School girls ass pet
Post by: squidmanheis on October 13, 2016, 10:12:18 am
School girls ass pet

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/R/3IrRW/School%20girls%20ass%20pet_cover.jpg) (http://pimpandhost.com/image/54922572-original.html)

File Name : School girls ass pet
Runtime : 14min 54s
File Size : 145 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/S/3IrS3/School%20girls%20ass%20pet_thumb_m.jpg) (http://pimpandhost.com/image/54922579-original.html)

Download Links:

School girls ass pet.rar (http://k2s.cc/file/043580cc4317a)
Title: Sitting on her oral slave
Post by: squidmanheis on October 13, 2016, 01:37:18 pm
Sitting on her oral slave

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/T/3IrTv/Sitting%20on%20her%20oral%20slave_cover.jpg) (http://pimpandhost.com/image/54922669-original.html)

File Name : Sitting on her oral slave
Runtime : 15min 15s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/T/3IrTF/Sitting%20on%20her%20oral%20slave_thumb_m.jpg) (http://pimpandhost.com/image/54922679-original.html)

Download Links:

Sitting on her oral slave.rar (http://k2s.cc/file/f788058dab0e1)
Title: Slave to a black queen
Post by: squidmanheis on October 13, 2016, 05:02:17 pm
Slave to a black queen

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/V/3IrVk/Slave%20to%20a%20black%20queen%20_cover.jpg) (http://pimpandhost.com/image/54922782-original.html)

File Name : Slave to a black queen
Runtime : 15min 22s
File Size : 150 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/V/3IrVt/Slave%20to%20a%20black%20queen%20_thumb_m.jpg) (http://pimpandhost.com/image/54922791-original.html)

Download Links:

Slave to a black queen .rar (http://k2s.cc/file/7c4515b8e31e9)
Title: Smother in my ass while I squirt on you
Post by: squidmanheis on October 13, 2016, 08:27:17 pm
Smother in my ass while I squirt on you

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/W/3IrWv/Smother%20in%20my%20ass%20while%20I%20squirt%20on%20you_cover.jpg) (http://pimpandhost.com/image/54922855-original.html)

File Name : Smother in my ass while I squirt on you
Runtime : 15min 2s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/W/3IrWx/Smother%20in%20my%20ass%20while%20I%20squirt%20on%20you_thumb_m.jpg) (http://pimpandhost.com/image/54922857-original.html)

Download Links:

Smother in my ass while I squirt on you.rar (http://k2s.cc/file/72a2b72f9102a)
Title: Smothered by a huge ass
Post by: squidmanheis on October 13, 2016, 11:52:16 pm
Smothered by a huge ass

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/X/3IrXl/Smothered%20by%20a%20huge%20ass_cover.jpg) (http://pimpandhost.com/image/54922907-original.html)

File Name : Smothered by a huge ass
Runtime : 15min 13s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/X/3IrXm/Smothered%20by%20a%20huge%20ass_thumb_m.jpg) (http://pimpandhost.com/image/54922908-original.html)

Download Links:

Smothered by a huge ass.rar (http://k2s.cc/file/62b6ba09d2d10)
Title: Smothered DEEP in Venezuelen snatch
Post by: squidmanheis on October 14, 2016, 03:17:16 am
Smothered DEEP in Venezuelen snatch

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/Z/3IrZh/Smothered%20DEEP%20in%20Venezuelen%20snatch_cover.jpg) (http://pimpandhost.com/image/54923027-original.html)

File Name : Smothered DEEP in Venezuelen snatch
Runtime : 14min 54s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/Z/3IrZB/Smothered%20DEEP%20in%20Venezuelen%20snatch_thumb_m.jpg) (http://pimpandhost.com/image/54923047-original.html)

Download Links:

Smothered DEEP in Venezuelen snatch.rar (http://k2s.cc/file/e69f5442d0a5e)
Title: Smothered good by two girls
Post by: squidmanheis on October 14, 2016, 06:42:05 am
Smothered good by two girls

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/0/3Is0P/Smothered%20good%20by%20two%20girls_cover.jpg) (http://pimpandhost.com/image/54923123-original.html)

File Name : Smothered good by two girls
Runtime : 15min 15s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/0/3Is0Q/Smothered%20good%20by%20two%20girls_thumb_m.jpg) (http://pimpandhost.com/image/54923124-original.html)

Download Links:

Smothered good by two girls.rar (http://k2s.cc/file/c92154415846f)
Title: Smothering the life out of him
Post by: squidmanheis on October 14, 2016, 10:07:14 am
Smothering the life out of him

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/1/3Is1n/Smothering%20the%20life%20out%20of%20him_cover.jpg) (http://pimpandhost.com/image/54923157-original.html)

File Name : Smothering the life out of him
Runtime : 15min 18s
File Size : 150 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/1/3Is1o/Smothering%20the%20life%20out%20of%20him_thumb_m.jpg) (http://pimpandhost.com/image/54923158-original.html)

Download Links:

Smothering the life out of him.rar (http://k2s.cc/file/c80da72aa89f4)
Title: Spontaneous domination
Post by: squidmanheis on October 14, 2016, 01:32:14 pm
Spontaneous domination

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/1/3Is1S/Spontaneous%20domination_cover.jpg) (http://pimpandhost.com/image/54923188-original.html)

File Name : Spontaneous domination
Runtime : 14min 31s
File Size : 142 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/1/3Is1U/Spontaneous%20domination_thumb_m.jpg) (http://pimpandhost.com/image/54923190-original.html)

Download Links:

Spontaneous domination.rar (http://k2s.cc/file/fc7dc4afe07e4)
Title: Squashed
Post by: squidmanheis on October 14, 2016, 04:57:04 pm

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/2/3Is2M/Squashed%20_cover.jpg) (http://pimpandhost.com/image/54923244-original.html)

File Name : Squashed
Runtime : 15min 9s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/2/3Is2P/Squashed%20_thumb_m.jpg) (http://pimpandhost.com/image/54923247-original.html)

Download Links:

Squashed .rar (http://k2s.cc/file/3c9ba50e53fdb)
Title: St Patricks day smother
Post by: squidmanheis on October 14, 2016, 08:22:14 pm
St  Patricks day smother

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/3/3Is3t/St.%20Patricks%20day%20smother_cover.jpg) (http://pimpandhost.com/image/54923287-original.html)

File Name : St. Patricks day smother
Runtime : 15min 14s
File Size : 149 MB
File Type: wmv
Resolution : 640x480


Download Links:

St. Patricks day smother.rar (http://k2s.cc/file/09b62ff915784)
Title: Suffocation in Angels room
Post by: squidmanheis on October 14, 2016, 11:47:12 pm
Suffocation in Angels room

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/4/3Is4i/Suffocation%20in%20Angels%20room_cover.jpg) (http://pimpandhost.com/image/54923338-original.html)

File Name : Suffocation in Angels room
Runtime : 16min 6s
File Size : 122 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/4/3Is4j/Suffocation%20in%20Angels%20room_thumb_m.jpg) (http://pimpandhost.com/image/54923339-original.html)

Download Links:

Suffocation in Angels room.rar (http://k2s.cc/file/396e7779fffbe)
Title: Sweaty Latina fucks his nose and tongue
Post by: squidmanheis on October 15, 2016, 03:12:12 am
Sweaty Latina fucks his nose and tongue

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/5/3Is5I/Sweaty%20Latina%20fucks%20his%20nose%20and%20tongue_cover.jpg) (http://pimpandhost.com/image/54923426-original.html)

File Name : Sweaty Latina fucks his nose and tongue
Runtime : 15min 20s
File Size : 150 MB
File Type: wmv
Resolution : 640x480


Download Links:

Sweaty Latina fucks his nose and tongue.rar (http://k2s.cc/file/f086f4fc0e76c)
Title: Take my full weight
Post by: squidmanheis on October 15, 2016, 06:37:11 am
Take my full weight

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/7/3Is7a/Take%20my%20full%20weight_cover.jpg) (http://pimpandhost.com/image/54923516-original.html)

File Name : Take my full weight
Runtime : 12min 1s
File Size : 117 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/7/3Is7b/Take%20my%20full%20weight_thumb_m.jpg) (http://pimpandhost.com/image/54923517-original.html)

Download Links:

Take my full weight.rar (http://k2s.cc/file/566024eabc5cc)
Title: The ass from heaven 2
Post by: squidmanheis on October 15, 2016, 10:02:08 am
The ass from heaven 2

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/8/3Is8i/The%20ass%20from%20heaven%202_cover.jpg) (http://pimpandhost.com/image/54923586-original.html)

File Name : The ass from heaven 2
Runtime : 12min 47s
File Size : 125 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/8/3Is8n/The%20ass%20from%20heaven%202_thumb_m.jpg) (http://pimpandhost.com/image/54923591-original.html)

Download Links:

The ass from heaven 2.rar (http://k2s.cc/file/354fc7e59e06a)
Title: The ass from heaven 3
Post by: squidmanheis on October 15, 2016, 01:27:08 pm
The ass from heaven 3

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/a/3Isa2/The%20ass%20from%20heaven%203_cover.jpg) (http://pimpandhost.com/image/54923694-original.html)

File Name : The ass from heaven 3
Runtime : 15min 2s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/a/3Isa4/The%20ass%20from%20heaven%203_thumb_m.jpg) (http://pimpandhost.com/image/54923696-original.html)

Download Links:

The ass from heaven 3.rar (http://k2s.cc/file/6dbb922cccf37)
Title: The ass from heaven
Post by: squidmanheis on October 15, 2016, 04:52:07 pm
The ass from heaven

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/c/3Isc5/The%20ass%20from%20heaven_cover.jpg) (http://pimpandhost.com/image/54923821-original.html)

File Name : The ass from heaven
Runtime : 15min 4s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/c/3Isca/The%20ass%20from%20heaven_thumb_m.jpg) (http://pimpandhost.com/image/54923826-original.html)

Download Links:

The ass from heaven.rar (http://k2s.cc/file/5a86bbc206a0d)
Title: The human shower 2
Post by: squidmanheis on October 15, 2016, 08:17:06 pm
The human shower 2

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/d/3Isd5/The%20human%20shower%202%20_cover.jpg) (http://pimpandhost.com/image/54923883-original.html)

File Name : The human shower 2
Runtime : 10min 51s
File Size : 113 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/d/3Isd6/The%20human%20shower%202%20_thumb_m.jpg) (http://pimpandhost.com/image/54923884-original.html)

Download Links:

The human shower 2 .rar (http://k2s.cc/file/12e1a3de188be)
Title: The life of a stool
Post by: squidmanheis on October 15, 2016, 11:41:47 pm
The life of a stool

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/d/3Isdg/The%20life%20of%20a%20stool_cover.jpg) (http://pimpandhost.com/image/54923894-original.html)

File Name : The life of a stool
Runtime : 11min 30s
File Size : 112 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/d/3Isdh/The%20life%20of%20a%20stool_thumb_m.jpg) (http://pimpandhost.com/image/54923895-original.html)

Download Links:

The life of a stool.rar (http://k2s.cc/file/33e8dc12afc9e)
Title: The partys on his face
Post by: squidmanheis on October 16, 2016, 03:06:47 am
The partys on his face

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/d/3IsdR/The%20partys%20on%20his%20face_cover.jpg) (http://pimpandhost.com/image/54923931-original.html)

File Name : The partys on his face
Runtime : 15min 19s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/d/3IsdT/The%20partys%20on%20his%20face_thumb_m.jpg) (http://pimpandhost.com/image/54923933-original.html)

Download Links:

The partys on his face.rar (http://k2s.cc/file/9ebd8f6d6159b)
Title: The Russian missionary position
Post by: squidmanheis on October 16, 2016, 06:31:46 am
The Russian missionary position

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/g/3IsgM/The%20Russian%20missionary%20position_cover.jpg) (http://pimpandhost.com/image/54924112-original.html)

File Name : The Russian missionary position
Runtime : 15min 8s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/g/3IsgO/The%20Russian%20missionary%20position_thumb_m.jpg) (http://pimpandhost.com/image/54924114-original.html)

Download Links:

The Russian missionary position.rar (http://k2s.cc/file/41fa1849b3612)
Title: Thick blonde discovers facesitting and ass worship 1
Post by: squidmanheis on October 16, 2016, 09:56:44 am
Thick blonde discovers facesitting and ass worship 1

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/h/3Ishr/Thick%20blonde%20discovers%20facesitting%20and%20ass%20worship%201_cover.jpg) (http://pimpandhost.com/image/54924153-original.html)

File Name : Thick blonde discovers facesitting and ass worship 1
Runtime : 14min 50s
File Size : 145 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/h/3Isht/Thick%20blonde%20discovers%20facesitting%20and%20ass%20worship%201_thumb_m.jpg) (http://pimpandhost.com/image/54924155-original.html)

Download Links:

Thick blonde discovers facesitting and ass worship 1.rar (http://k2s.cc/file/f812ac4a1a83c)
Title: Thick blonde discovers facesitting and ass worship 2
Post by: squidmanheis on October 16, 2016, 01:21:44 pm
Thick blonde discovers facesitting and ass worship 2

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/i/3Isi8/Thick%20blonde%20discovers%20facesitting%20and%20ass%20worship%202_cover.jpg) (http://pimpandhost.com/image/54924196-original.html)

File Name : Thick blonde discovers facesitting and ass worship 2
Runtime : 15min 1s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/i/3Isia/Thick%20blonde%20discovers%20facesitting%20and%20ass%20worship%202_thumb_m.jpg) (http://pimpandhost.com/image/54924198-original.html)

Download Links:

Thick blonde discovers facesitting and ass worship 2.rar (http://k2s.cc/file/c34dc35e36487)
Title: Thick blonde smother ass worship finale
Post by: squidmanheis on October 16, 2016, 04:46:45 pm
Thick blonde smother ass worship finale

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/i/3Isir/Thick%20blonde%20smother%20ass%20worship%20finale%20_cover.jpg) (http://pimpandhost.com/image/54924215-original.html)

File Name : Thick blonde smother ass worship finale
Runtime : 14min 59s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/i/3Isis/Thick%20blonde%20smother%20ass%20worship%20finale%20_thumb_m.jpg) (http://pimpandhost.com/image/54924216-original.html)

Download Links:

Thick blonde smother ass worship finale .rar (http://k2s.cc/file/c9040de6b28ee)
Title: Tied down and smothered
Post by: squidmanheis on October 16, 2016, 08:11:42 pm
Tied down and smothered

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/j/3Isj1/Tied%20down%20and%20smothered_cover.jpg) (http://pimpandhost.com/image/54924251-original.html)

File Name : Tied down and smothered
Runtime : 14min 47s
File Size : 144 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/j/3Isj2/Tied%20down%20and%20smothered_thumb_m.jpg) (http://pimpandhost.com/image/54924252-original.html)

Download Links:

Tied down and smothered.rar (http://k2s.cc/file/3db589d0191c1)
Title: Tied gagged blinded smothered and butt drops
Post by: squidmanheis on October 16, 2016, 11:36:43 pm
Tied gagged blinded smothered and butt drops

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/j/3IsjI/Tied%20gagged%20blinded%20smothered%20and%20butt%20drops%20_cover.jpg) (http://pimpandhost.com/image/54924294-original.html)

File Name : Tied gagged blinded smothered and butt drops
Runtime : 14min 42s
File Size : 144 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/j/3IsjJ/Tied%20gagged%20blinded%20smothered%20and%20butt%20drops%20_thumb_m.jpg) (http://pimpandhost.com/image/54924295-original.html)

Download Links:

Tied gagged blinded smothered and butt drops .rar (http://k2s.cc/file/4510bbef7be8f)
Title: Tiffany becomes a facesitter
Post by: squidmanheis on October 17, 2016, 03:01:43 am
Tiffany becomes a facesitter

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/k/3Iskb/Tiffany%20becomes%20a%20facesitter_cover.jpg) (http://pimpandhost.com/image/54924323-original.html)

File Name : Tiffany becomes a facesitter
Runtime : 15min 11s
File Size : 149 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/k/3Iskd/Tiffany%20becomes%20a%20facesitter_thumb_m.jpg) (http://pimpandhost.com/image/54924325-original.html)

Download Links:

Tiffany becomes a facesitter.rar (http://k2s.cc/file/4368c0fbb8dad)
Title: Tiffany nude smothering
Post by: squidmanheis on October 17, 2016, 06:26:42 am
Tiffany nude smothering

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/k/3IskO/Tiffany%20nude%20smothering_cover.jpg) (http://pimpandhost.com/image/54924362-original.html)

File Name : Tiffany nude smothering
Runtime : 15min 8s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/k/3IskP/Tiffany%20nude%20smothering_thumb_m.jpg) (http://pimpandhost.com/image/54924363-original.html)

Download Links:

Tiffany nude smothering.rar (http://k2s.cc/file/310e1b23a02e9)
Title: Tiny guy is her bitch
Post by: squidmanheis on October 17, 2016, 09:51:41 am
Tiny guy is her bitch

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/l/3Islr/Tiny%20guy%20is%20her%20bitch%20_cover.jpg) (http://pimpandhost.com/image/54924401-original.html)

File Name : Tiny guy is her bitch
Runtime : 15min 12s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/l/3Islu/Tiny%20guy%20is%20her%20bitch%20_thumb_m.jpg) (http://pimpandhost.com/image/54924404-original.html)

Download Links:

Tiny guy is her bitch .rar (http://k2s.cc/file/0f8237e4c7e5b)
Title: Toiletface gets dominated
Post by: squidmanheis on October 17, 2016, 01:16:29 pm
Toiletface gets dominated

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/m/3Ism0/Toiletface%20gets%20dominated_cover.jpg) (http://pimpandhost.com/image/54924436-original.html)

File Name : Toiletface gets dominated
Runtime : 14min 52s
File Size : 112 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/m/3Ism1/Toiletface%20gets%20dominated_thumb_m.jpg) (http://pimpandhost.com/image/54924437-original.html)

Download Links:

Toiletface gets dominated.rar (http://k2s.cc/file/1603e58472546)
Title: Tongue fucking Felonys ass
Post by: squidmanheis on October 17, 2016, 04:41:39 pm
Tongue fucking Felonys ass

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/m/3Ismm/Tongue%20fucking%20Felonys%20ass_cover.jpg) (http://pimpandhost.com/image/54924458-original.html)

File Name : Tongue fucking Felonys ass
Runtime : 13min 47s
File Size : 135 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/m/3Ismn/Tongue%20fucking%20Felonys%20ass_thumb_m.jpg) (http://pimpandhost.com/image/54924459-original.html)

Download Links:

Tongue fucking Felonys ass.rar (http://k2s.cc/file/401aee475197a)
Title: Total Domination
Post by: squidmanheis on October 17, 2016, 08:06:40 pm
Total Domination

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/m/3IsmQ/Total%20Domination%20_cover.jpg) (http://pimpandhost.com/image/54924488-original.html)

File Name : Total Domination
Runtime : 11min 25s
File Size : 112 MB
File Type: wmv
Resolution : 640x480


Download Links:

Total Domination .rar (http://k2s.cc/file/3c41f003d6132)
Title: Under Alexiss black dress
Post by: squidmanheis on October 17, 2016, 11:31:38 pm
Under Alexiss black dress

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/n/3Isno/Under%20Alexiss%20black%20dress_cover.jpg) (http://pimpandhost.com/image/54924522-original.html)

File Name : Under Alexiss black dress
Runtime : 15min 30s
File Size : 151 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/n/3Isnp/Under%20Alexiss%20black%20dress_thumb_m.jpg) (http://pimpandhost.com/image/54924523-original.html)

Download Links:

Under Alexiss black dress.rar (http://k2s.cc/file/9ec6faa29b86f)
Title: Under Felony finale
Post by: squidmanheis on October 18, 2016, 02:56:39 am
Under Felony finale

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/n/3Isnx/Under%20Felony%20finale_cover.jpg) (http://pimpandhost.com/image/54924531-original.html)

File Name : Under Felony finale
Runtime : 14min 36s
File Size : 143 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/n/3Isny/Under%20Felony%20finale_thumb_m.jpg) (http://pimpandhost.com/image/54924532-original.html)

Download Links:

Under Felony finale.rar (http://k2s.cc/file/bb4c7502fda46)
Title: Using his face so I can cum again
Post by: squidmanheis on October 18, 2016, 06:21:36 am
Using his face so I can cum again

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/n/3IsnU/Using%20his%20face%20so%20I%20can%20cum%20again_cover.jpg) (http://pimpandhost.com/image/54924554-original.html)

File Name : Using his face so I can cum again
Runtime : 15min 3s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/n/3IsnW/Using%20his%20face%20so%20I%20can%20cum%20again_thumb_m.jpg) (http://pimpandhost.com/image/54924556-original.html)

Download Links:

Using his face so I can cum again.rar (http://k2s.cc/file/9285121a4c88d)
Title: Vicious bitch in boots
Post by: squidmanheis on October 18, 2016, 09:46:36 am
Vicious bitch in boots

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/o/3Isoq/Vicious%20bitch%20in%20boots_cover.jpg) (http://pimpandhost.com/image/54924586-original.html)

File Name : Vicious bitch in boots
Runtime : 14min 9s
File Size : 138 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/o/3Isor/Vicious%20bitch%20in%20boots_thumb_m.jpg) (http://pimpandhost.com/image/54924587-original.html)

Download Links:

Vicious bitch in boots.rar (http://k2s.cc/file/eb6f80505caf6)
Title: Violent smothering
Post by: squidmanheis on October 18, 2016, 01:11:38 pm
Violent smothering

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/o/3IsoZ/Violent%20smothering_cover.jpg) (http://pimpandhost.com/image/54924621-original.html)

File Name : Violent smothering
Runtime : 14min 34s
File Size : 151 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/p/3Isp2/Violent%20smothering_thumb_m.jpg) (http://pimpandhost.com/image/54924624-original.html)

Download Links:

Violent smothering.rar (http://k2s.cc/file/c6e7fdf548d62)
Title: Vulgar and crude smother and worship session
Post by: squidmanheis on October 18, 2016, 04:36:40 pm
Vulgar and crude smother and worship session

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/p/3IspS/Vulgar%20and%20crude%20smother%20and%20worship%20session_cover.jpg) (http://pimpandhost.com/image/54924676-original.html)

File Name : Vulgar and crude smother and worship session
Runtime : 15min 13s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/p/3IspV/Vulgar%20and%20crude%20smother%20and%20worship%20session_thumb_m.jpg) (http://pimpandhost.com/image/54924679-original.html)

Download Links:

Vulgar and crude smother and worship session.rar (http://k2s.cc/file/fb7911f763f8e)
Title: You hold him down and Ill sit on him
Post by: squidmanheis on October 18, 2016, 08:01:36 pm
You hold him down and Ill sit on him

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/q/3Isqv/You%20hold%20him%20down%20and%20Ill%20sit%20on%20him_cover.jpg) (http://pimpandhost.com/image/54924715-original.html)

File Name : You hold him down and Ill sit on him
Runtime : 14min 57s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/q/3Isqw/You%20hold%20him%20down%20and%20Ill%20sit%20on%20him_thumb_m.jpg) (http://pimpandhost.com/image/54924716-original.html)

Download Links:

You hold him down and Ill sit on him.rar (http://k2s.cc/file/86fdf734389c9)
Title: You suffocate while I masturbate
Post by: squidmanheis on October 18, 2016, 11:26:37 pm
You suffocate while I masturbate

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/q/3IsqN/You%20suffocate%20while%20I%20masturbate_cover.jpg) (http://pimpandhost.com/image/54924733-original.html)

File Name : You suffocate while I masturbate
Runtime : 14min 44s
File Size : 144 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/q/3IsqP/You%20suffocate%20while%20I%20masturbate_thumb_m.jpg) (http://pimpandhost.com/image/54924735-original.html)

Download Links:

You suffocate while I masturbate.rar (http://k2s.cc/file/7650e2ba6179d)
Title: Young girl with hairy pussy 2
Post by: squidmanheis on October 19, 2016, 02:51:34 am
Young girl with hairy pussy 2

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/r/3IsrY/Young%20girl%20with%20hairy%20pussy%202_cover.jpg) (http://pimpandhost.com/image/54924806-original.html)

File Name : Young girl with hairy pussy 2
Runtime : 15min 2s
File Size : 145 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/r/3IsrZ/Young%20girl%20with%20hairy%20pussy%202_thumb_m.jpg) (http://pimpandhost.com/image/54924807-original.html)

Download Links:

Young girl with hairy pussy 2.rar (http://k2s.cc/file/f40d9788dc668)
Title: Young girl with hairy pussy finale
Post by: squidmanheis on October 19, 2016, 06:16:32 am
Young girl with hairy pussy finale

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/s/3Issf/Young%20girl%20with%20hairy%20pussy%20finale_cover.jpg) (http://pimpandhost.com/image/54924823-original.html)

File Name : Young girl with hairy pussy finale
Runtime : 13min 16s
File Size : 128 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/s/3Issh/Young%20girl%20with%20hairy%20pussy%20finale_thumb_m.jpg) (http://pimpandhost.com/image/54924825-original.html)

Download Links:

Young girl with hairy pussy finale.rar (http://k2s.cc/file/a5c6a245d817d)
Title: Young girl with hairy pussy
Post by: squidmanheis on October 19, 2016, 09:41:33 am
Young girl with hairy pussy

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/s/3IssQ/Young%20girl%20with%20hairy%20pussy_cover.jpg) (http://pimpandhost.com/image/54924860-original.html)

File Name : Young girl with hairy pussy
Runtime : 12min 0s
File Size : 116 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/s/3IssR/Young%20girl%20with%20hairy%20pussy_thumb_m.jpg) (http://pimpandhost.com/image/54924861-original.html)

Download Links:

Young girl with hairy pussy.rar (http://k2s.cc/file/aca847d5a2bff)
Title: Young girls torture cock for first time
Post by: squidmanheis on October 19, 2016, 01:06:32 pm
Young girls torture cock for first time

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/t/3Istu/Young%20girls%20torture%20cock%20for%20first%20time_cover.jpg) (http://pimpandhost.com/image/54924900-original.html)

File Name : Young girls torture cock for first time
Runtime : 16min 9s
File Size : 158 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/t/3IstI/Young%20girls%20torture%20cock%20for%20first%20time_thumb_m.jpg) (http://pimpandhost.com/image/54924914-original.html)

Download Links:

Young girls torture cock for first time.rar (http://k2s.cc/file/7eda8821dcba5)
Title: 095 097 sveta brusser
Post by: squidmanheis on November 15, 2016, 07:05:04 am
095-097 sveta brusser

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/X/3XrXQ/095-097%20sveta%20brusser_cover.jpg) (http://pimpandhost.com/image/58497858-original.html)

File Name : 095-097 sveta brusser
Runtime : 19min 19s
File Size : 204 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/X/3XrXS/095-097%20sveta%20brusser_thumb_0.jpg) (http://pimpandhost.com/image/58497860-original.html)

Download Links:

095-097 sveta brusser.rar (http://k2s.cc/file/e338ca6d731ff)
Title: 098 099 ira onyxCL
Post by: squidmanheis on November 15, 2016, 10:30:04 am
098-099 ira onyxCL

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/Z/3XrZu/098-099%20ira%20onyxCL_cover.jpg) (http://pimpandhost.com/image/58497960-original.html)

File Name : 098-099 ira onyxCL
Runtime : 11min 51s
File Size : 125 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/Z/3XrZv/098-099%20ira%20onyxCL_thumb_0.jpg) (http://pimpandhost.com/image/58497961-original.html)

Download Links:

098-099 ira onyxCL.rar (http://k2s.cc/file/1f518c2028a93)
Title: 105 alisa
Post by: squidmanheis on November 15, 2016, 01:55:07 pm
105 alisa

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/0/3Xs0f/105%20alisa_cover.jpg) (http://pimpandhost.com/image/58498007-original.html)

File Name : 105 alisa
Runtime : 3min 56s
File Size : 39.8 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/0/3Xs0i/105%20alisa_thumb_0.jpg) (http://pimpandhost.com/image/58498010-original.html)

Download Links:

105 alisa.rar (http://k2s.cc/file/a4c90b14b19c6)
Title: 111 112 nata
Post by: squidmanheis on November 15, 2016, 05:20:03 pm
111-112 nata

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/0/3Xs0L/111-112%20nata_cover.jpg) (http://pimpandhost.com/image/58498039-original.html)

File Name : 111-112 nata
Runtime : 11min 58s
File Size : 90.4 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/0/3Xs0P/111-112%20nata_thumb_0.jpg) (http://pimpandhost.com/image/58498043-original.html)

Download Links:

111-112 nata.rar (http://k2s.cc/file/2bf64bf248f6f)
Title: 113 114 nika
Post by: squidmanheis on November 15, 2016, 08:45:04 pm
113-114 nika

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/1/3Xs1e/113-114%20nika_cover.jpg) (http://pimpandhost.com/image/58498068-original.html)

File Name : 113-114 nika
Runtime : 12min 9s
File Size : 91.8 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/1/3Xs1i/113-114%20nika_thumb_0.jpg) (http://pimpandhost.com/image/58498072-original.html)

Download Links:

113-114 nika.rar (http://k2s.cc/file/ab2f627907368)
Title: 116 nika nata
Post by: squidmanheis on November 16, 2016, 12:10:03 am
116 nika nata

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/1/3Xs1x/116%20nika%20nata_cover.jpg) (http://pimpandhost.com/image/58498087-original.html)

File Name : 116 nika nata
Runtime : 11min 52s
File Size : 89.7 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/1/3Xs1D/116%20nika%20nata_thumb_0.jpg) (http://pimpandhost.com/image/58498093-original.html)

Download Links:

116 nika nata.rar (http://k2s.cc/file/8cfd16e737f58)
Title: 117 119 nata
Post by: squidmanheis on November 16, 2016, 03:35:02 am
117-119 nata

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/3/3Xs3B/117-119%20nata_cover.jpg) (http://pimpandhost.com/image/58498215-original.html)

File Name : 117-119 nata
Runtime : 17min 56s
File Size : 135 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/3/3Xs3J/117-119%20nata_thumb_0.jpg) (http://pimpandhost.com/image/58498223-original.html)

Download Links:

117-119 nata.rar (http://k2s.cc/file/ee47886b367ed)
Title: 120 maya
Post by: squidmanheis on November 16, 2016, 07:00:07 am
120 maya

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/5/3Xs5p/120%20maya_cover.jpg) (http://pimpandhost.com/image/58498327-original.html)

File Name : 120 maya
Runtime : 5min 43s
File Size : 43.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/5/3Xs5q/120%20maya_thumb_0.jpg) (http://pimpandhost.com/image/58498328-original.html)

Download Links:

120 maya.rar (http://k2s.cc/file/b825446d0fbd0)
Title: 121 Lera Yulya
Post by: squidmanheis on November 16, 2016, 10:25:03 am
121 Lera  Yulya

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/5/3Xs5z/121%20Lera%20%20Yulya_cover.jpg) (http://pimpandhost.com/image/58498337-original.html)

File Name : 121 Lera  Yulya
Runtime : 11min 42s
File Size : 88.3 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/5/3Xs5A/121%20Lera%20%20Yulya_thumb_0.jpg) (http://pimpandhost.com/image/58498338-original.html)

Download Links:

121 Lera  Yulya.rar (http://k2s.cc/file/12af201bfc254)
Title: 122 maya
Post by: squidmanheis on November 16, 2016, 01:50:01 pm
122 maya

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/6/3Xs6u/122%20maya_cover.jpg) (http://pimpandhost.com/image/58498394-original.html)

File Name : 122 maya
Runtime : 13min 25s
File Size : 101 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/6/3Xs6C/122%20maya_thumb_0.jpg) (http://pimpandhost.com/image/58498402-original.html)

Download Links:

122 maya.rar (http://k2s.cc/file/e3260fd854452)
Title: 123 lera pov
Post by: squidmanheis on November 16, 2016, 05:14:58 pm
123 lera pov

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/7/3Xs7E/123%20lera%20pov_cover.jpg) (http://pimpandhost.com/image/58498466-original.html)

File Name : 123 lera pov
Runtime : 6min 37s
File Size : 49.9 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/7/3Xs7H/123%20lera%20pov_thumb_0.jpg) (http://pimpandhost.com/image/58498469-original.html)

Download Links:

123 lera pov.rar (http://k2s.cc/file/4b0b1bbc49cbc)
Title: 124 ira pov
Post by: squidmanheis on November 16, 2016, 08:40:02 pm
124 ira pov

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/8/3Xs8b/124%20ira%20pov_cover.jpg) (http://pimpandhost.com/image/58498499-original.html)

File Name : 124 ira pov
Runtime : 6min 9s
File Size : 46.4 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/8/3Xs8h/124%20ira%20pov_thumb_0.jpg) (http://pimpandhost.com/image/58498505-original.html)

Download Links:

124 ira pov.rar (http://k2s.cc/file/3ef3526d75d8f)
Title: 125 126 lera
Post by: squidmanheis on November 17, 2016, 12:04:59 am
125-126 lera

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/8/3Xs8Q/125-126%20lera_cover.jpg) (http://pimpandhost.com/image/58498540-original.html)

File Name : 125-126 lera
Runtime : 12min 40s
File Size : 95.7 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/8/3Xs8T/125-126%20lera_thumb_0.jpg) (http://pimpandhost.com/image/58498543-original.html)

Download Links:

125-126 lera.rar (http://k2s.cc/file/e09348dbc9b19)
Title: 127 128 lera
Post by: squidmanheis on November 17, 2016, 03:29:58 am
127-128 lera

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/9/3Xs9K/127-128%20lera_cover.jpg) (http://pimpandhost.com/image/58498596-original.html)

File Name : 127-128 lera
Runtime : 11min 55s
File Size : 90.0 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/9/3Xs9O/127-128%20lera_thumb_0.jpg) (http://pimpandhost.com/image/58498600-original.html)

Download Links:

127-128 lera.rar (http://k2s.cc/file/bdff6e929287b)
Title: 129 130 irina
Post by: squidmanheis on November 17, 2016, 06:54:55 am
129-130 irina

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/a/3XsaB/129-130%20irina_cover.jpg) (http://pimpandhost.com/image/58498649-original.html)

File Name : 129-130 irina
Runtime : 14min 11s
File Size : 107 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/a/3XsaE/129-130%20irina_thumb_0.jpg) (http://pimpandhost.com/image/58498652-original.html)

Download Links:

129-130 irina.rar (http://k2s.cc/file/bb504ec5e8781)
Title: facesi 02 CL
Post by: squidmanheis on November 17, 2016, 10:19:55 am
facesi 02 CL

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/b/3XsbM/facesi%2002%20CL_cover.jpg) (http://pimpandhost.com/image/58498722-original.html)

File Name : facesi 02 CL
Runtime : 3min 0s
File Size : 30.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/b/3XsbR/facesi%2002%20CL_thumb_0.jpg) (http://pimpandhost.com/image/58498727-original.html)

Download Links:

facesi 02 CL.rar (http://k2s.cc/file/84abed16c13a6)
Title: facesi 03 CL
Post by: squidmanheis on November 17, 2016, 01:44:52 pm
facesi 03 CL

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/c/3Xsc8/facesi%2003%20CL_cover.jpg) (http://pimpandhost.com/image/58498744-original.html)

File Name : facesi 03 CL
Runtime : 3min 0s
File Size : 30.2 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/c/3Xscc/facesi%2003%20CL_thumb_0.jpg) (http://pimpandhost.com/image/58498748-original.html)

Download Links:

facesi 03 CL.rar (http://k2s.cc/file/4aedfb47eb307)
Title: facesi t01 CL
Post by: squidmanheis on November 17, 2016, 05:09:54 pm
facesi t01 CL

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/c/3XscO/facesi%20t01%20CL_cover.jpg) (http://pimpandhost.com/image/58498786-original.html)

File Name : facesi t01 CL
Runtime : 3min 0s
File Size : 30.2 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/c/3XscV/facesi%20t01%20CL_thumb_0.jpg) (http://pimpandhost.com/image/58498793-original.html)

Download Links:

facesi t01 CL.rar (http://k2s.cc/file/6e76c63487be8)
Title: Hot facesitting 0 Mistress Mariana
Post by: squidmanheis on November 17, 2016, 08:34:40 pm
Hot facesitting 0 Mistress Mariana

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/n/3Xsn6/Hot%20facesitting%200%20Mistress%20Mariana%20_cover.jpg) (http://pimpandhost.com/image/58499424-original.html)

File Name : Hot facesitting 0 Mistress Mariana
Runtime : 15min 43s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/n/3Xsn7/Hot%20facesitting%200%20Mistress%20Mariana%20_thumb_0.jpg) (http://pimpandhost.com/image/58499425-original.html)

Download Links:

Hot facesitting 0 Mistress Mariana .rar (http://k2s.cc/file/0b04c0d2f3dba)
Title: Hot facesitting 052
Post by: squidmanheis on November 17, 2016, 11:59:56 pm
Hot facesitting 052

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/o/3Xsoe/Hot%20facesitting%20052_cover.jpg) (http://pimpandhost.com/image/58499494-original.html)

File Name : Hot facesitting 052
Runtime : 18min 29s
File Size : 272 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/o/3Xsoj/Hot%20facesitting%20052_thumb_0.jpg) (http://pimpandhost.com/image/58499499-original.html)

Download Links:

Hot facesitting 052.rar (http://k2s.cc/file/9d2dd7e96b6a8)
Title: Hot facesitting 1 Goddess Mary
Post by: squidmanheis on November 18, 2016, 03:24:50 am
Hot facesitting 1 Goddess Mary

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/p/3Xspl/Hot%20facesitting%201%20Goddess%20Mary%20_cover.jpg) (http://pimpandhost.com/image/58499563-original.html)

File Name : Hot facesitting 1 Goddess Mary
Runtime : 9min 39s
File Size : 147 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/p/3Xspn/Hot%20facesitting%201%20Goddess%20Mary%20_thumb_0.jpg) (http://pimpandhost.com/image/58499565-original.html)

Download Links:

Hot facesitting 1 Goddess Mary .rar (http://k2s.cc/file/5e91d2d020f8b)
Title: Hot facesitting 1 Mistress Margarita
Post by: squidmanheis on November 18, 2016, 06:49:52 am
Hot facesitting 1 Mistress Margarita

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/p/3XspJ/Hot%20facesitting%201%20Mistress%20Margarita%20_cover.jpg) (http://pimpandhost.com/image/58499587-original.html)

File Name : Hot facesitting 1 Mistress Margarita
Runtime : 16min 49s
File Size : 255 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/p/3XspK/Hot%20facesitting%201%20Mistress%20Margarita%20_thumb_0.jpg) (http://pimpandhost.com/image/58499588-original.html)

Download Links:

Hot facesitting 1 Mistress Margarita .rar (http://k2s.cc/file/fdd6a7addc790)
Title: Hot facesitting 1 Mistress Olga
Post by: squidmanheis on November 18, 2016, 10:14:47 am
Hot facesitting 1 Mistress Olga

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/r/3Xsr6/Hot%20facesitting%201%20Mistress%20Olga%20_cover.jpg) (http://pimpandhost.com/image/58499672-original.html)

File Name : Hot facesitting 1 Mistress Olga
Runtime : 18min 31s
File Size : 173 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/r/3Xsr8/Hot%20facesitting%201%20Mistress%20Olga%20_thumb_0.jpg) (http://pimpandhost.com/image/58499674-original.html)

Download Links:

Hot facesitting 1 Mistress Olga .rar (http://k2s.cc/file/fb28ffe8a00ba)
Title: Hot facesitting 1 Young Brunette Part One
Post by: squidmanheis on November 18, 2016, 01:39:49 pm
Hot facesitting 1 Young Brunette Part One

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/r/3XsrY/Hot%20facesitting%201%20Young%20Brunette%20Part%20One_cover.jpg) (http://pimpandhost.com/image/58499726-original.html)

File Name : Hot facesitting 1 Young Brunette Part One
Runtime : 10min 53s
File Size : 160 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/r/3XsrZ/Hot%20facesitting%201%20Young%20Brunette%20Part%20One_thumb_0.jpg) (http://pimpandhost.com/image/58499727-original.html)

Download Links:

Hot facesitting 1 Young Brunette Part One.rar (http://k2s.cc/file/640b5cc0d1f49)
Title: Hot facesitting 2 Goddess July
Post by: squidmanheis on November 18, 2016, 05:04:48 pm
Hot facesitting 2 Goddess July

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/s/3Xssp/Hot%20facesitting%202%20Goddess%20July%20_cover.jpg) (http://pimpandhost.com/image/58499753-original.html)

File Name : Hot facesitting 2 Goddess July
Runtime : 16min 24s
File Size : 260 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/s/3Xssq/Hot%20facesitting%202%20Goddess%20July%20_thumb_0.jpg) (http://pimpandhost.com/image/58499754-original.html)

Download Links:

Hot facesitting 2 Goddess July .rar (http://k2s.cc/file/ea0bed73742fa)
Title: Hot facesitting 2 Mistress Liza
Post by: squidmanheis on November 18, 2016, 08:29:48 pm
Hot facesitting 2 Mistress Liza

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/s/3XssT/Hot%20facesitting%202%20Mistress%20Liza%20_cover.jpg) (http://pimpandhost.com/image/58499783-original.html)

File Name : Hot facesitting 2 Mistress Liza
Runtime : 17min 20s
File Size : 162 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/s/3XssU/Hot%20facesitting%202%20Mistress%20Liza%20_thumb_0.jpg) (http://pimpandhost.com/image/58499784-original.html)

Download Links:

Hot facesitting 2 Mistress Liza .rar (http://k2s.cc/file/4aaf8d5028ffb)
Title: Hot facesitting 2 Three Hottest Mistresses
Post by: squidmanheis on November 18, 2016, 11:54:50 pm
Hot facesitting 2 Three Hottest Mistresses

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/t/3Xst4/Hot%20facesitting%202%20Three%20Hottest%20Mistresses_cover.jpg) (http://pimpandhost.com/image/58499794-original.html)

File Name : Hot facesitting 2 Three Hottest Mistresses
Runtime : 20min 55s
File Size : 331 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/t/3Xst6/Hot%20facesitting%202%20Three%20Hottest%20Mistresses_thumb_0.jpg) (http://pimpandhost.com/image/58499796-original.html)

Download Links:

Hot facesitting 2 Three Hottest Mistresses.rar (http://k2s.cc/file/b71c09e6c6e7c)
Title: Hot facesitting 2 Three Young School Bitches
Post by: squidmanheis on November 19, 2016, 03:19:45 am
Hot facesitting 2 Three Young School-Bitches

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/t/3XstH/Hot%20facesitting%202%20Three%20Young%20School-Bitches%20_cover.jpg) (http://pimpandhost.com/image/58499833-original.html)

File Name : Hot facesitting 2 Three Young School-Bitches
Runtime : 13min 39s
File Size : 203 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/t/3XstI/Hot%20facesitting%202%20Three%20Young%20School-Bitches%20_thumb_0.jpg) (http://pimpandhost.com/image/58499834-original.html)

Download Links:

Hot facesitting 2 Three Young School-Bitches .rar (http://k2s.cc/file/2fb65158344df)
Title: Hot facesitting 2
Post by: squidmanheis on November 19, 2016, 06:44:46 am
Hot facesitting 2

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/t/3XstZ/Hot%20facesitting%202_cover.jpg) (http://pimpandhost.com/image/58499851-original.html)

File Name : Hot facesitting 2
Runtime : 12min 36s
File Size : 299 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/u/3Xsu0/Hot%20facesitting%202_thumb_0.jpg) (http://pimpandhost.com/image/58499852-original.html)

Download Links:

Hot facesitting 2.rar (http://k2s.cc/file/e2fc4cbf2a4ad)
Title: Hot facesitting 3 FACESITTING
Post by: squidmanheis on November 19, 2016, 10:09:46 am
Hot facesitting 3 FACESITTING

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/u/3Xsus/Hot%20facesitting%203%20FACESITTING%20_cover.jpg) (http://pimpandhost.com/image/58499880-original.html)

File Name : Hot facesitting 3 FACESITTING
Runtime : 14min 44s
File Size : 224 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/u/3Xsuv/Hot%20facesitting%203%20FACESITTING%20_thumb_0.jpg) (http://pimpandhost.com/image/58499883-original.html)

Download Links:

Hot facesitting 3 FACESITTING .rar (http://k2s.cc/file/eaa8fe6d02c67)
Title: Hot facesitting 3 Goddess Juliana
Post by: squidmanheis on November 19, 2016, 01:34:44 pm
Hot facesitting 3 Goddess Juliana

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3Xsv4/Hot%20facesitting%203%20Goddess%20Juliana%20_cover.jpg) (http://pimpandhost.com/image/58499918-original.html)

File Name : Hot facesitting 3 Goddess Juliana
Runtime : 11min 16s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3Xsv6/Hot%20facesitting%203%20Goddess%20Juliana%20_thumb_0.jpg) (http://pimpandhost.com/image/58499920-original.html)

Download Links:

Hot facesitting 3 Goddess Juliana .rar (http://k2s.cc/file/920760a08b9bd)
Title: Hot facesitting 3 Oksana Marika
Post by: squidmanheis on November 19, 2016, 04:59:43 pm
Hot facesitting 3 Oksana   Marika

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3XsvA/Hot%20facesitting%203%20Oksana%20%20%20Marika%20_cover.jpg) (http://pimpandhost.com/image/58499950-original.html)

File Name : Hot facesitting 3 Oksana   Marika
Runtime : 14min 4s
File Size : 131 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3XsvB/Hot%20facesitting%203%20Oksana%20%20%20Marika%20_thumb_0.jpg) (http://pimpandhost.com/image/58499951-original.html)

Download Links:

Hot facesitting 3 Oksana   Marika .rar (http://k2s.cc/file/92775a6b0d733)
Title: Hot facesitting 3 Young Brunette Part Two
Post by: squidmanheis on November 19, 2016, 08:24:43 pm
Hot facesitting 3 Young Brunette Part Two

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3XsvR/Hot%20facesitting%203%20Young%20Brunette%20Part%20Two%20_cover.jpg) (http://pimpandhost.com/image/58499967-original.html)

File Name : Hot facesitting 3 Young Brunette Part Two
Runtime : 14min 12s
File Size : 209 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3XsvS/Hot%20facesitting%203%20Young%20Brunette%20Part%20Two%20_thumb_0.jpg) (http://pimpandhost.com/image/58499968-original.html)

Download Links:

Hot facesitting 3 Young Brunette Part Two .rar (http://k2s.cc/file/c8ab850b97940)
Title: Hot facesitting 3 Young Goddess Anna
Post by: squidmanheis on November 19, 2016, 11:49:57 pm
Hot facesitting 3 Young Goddess Anna

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/w/3XswN/Hot%20facesitting%203%20Young%20Goddess%20Anna_cover.jpg) (http://pimpandhost.com/image/58500025-original.html)

File Name : Hot facesitting 3 Young Goddess Anna
Runtime : 13min 16s
File Size : 210 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/w/3XswP/Hot%20facesitting%203%20Young%20Goddess%20Anna_thumb_0.jpg) (http://pimpandhost.com/image/58500027-original.html)

Download Links:

Hot facesitting 3 Young Goddess Anna.rar (http://k2s.cc/file/250bea8d8a2de)
Title: Hot facesitting 3
Post by: squidmanheis on November 20, 2016, 03:14:40 am
Hot facesitting 3

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/x/3Xsxv/Hot%20facesitting%203_cover.jpg) (http://pimpandhost.com/image/58500069-original.html)

File Name : Hot facesitting 3
Runtime : 10min 59s
File Size : 261 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/x/3Xsxw/Hot%20facesitting%203_thumb_0.jpg) (http://pimpandhost.com/image/58500070-original.html)

Download Links:

Hot facesitting 3.rar (http://k2s.cc/file/8b3ac0b3eb389)
Title: Hot facesitting 4 Goddesses Lera and Dasha
Post by: squidmanheis on November 20, 2016, 06:39:40 am
Hot facesitting 4 Goddesses Lera and Dasha

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/x/3XsxO/Hot%20facesitting%204%20Goddesses%20Lera%20and%20Dasha_cover.jpg) (http://pimpandhost.com/image/58500088-original.html)

File Name : Hot facesitting 4 Goddesses Lera and Dasha
Runtime : 13min 8s
File Size : 195 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/x/3XsxP/Hot%20facesitting%204%20Goddesses%20Lera%20and%20Dasha_thumb_0.jpg) (http://pimpandhost.com/image/58500089-original.html)

Download Links:

Hot facesitting 4 Goddesses Lera and Dasha.rar (http://k2s.cc/file/7faac822880d6)
Title: Hot facesitting 4 Mistress Katya and Mistress Julia
Post by: squidmanheis on November 20, 2016, 10:04:42 am
Hot facesitting 4 Mistress Katya and Mistress Julia

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/y/3Xsy0/Hot%20facesitting%204%20Mistress%20Katya%20and%20Mistress%20Julia%20_cover.jpg) (http://pimpandhost.com/image/58500100-original.html)

File Name : Hot facesitting 4 Mistress Katya and Mistress Julia
Runtime : 12min 9s
File Size : 181 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/y/3Xsy5/Hot%20facesitting%204%20Mistress%20Katya%20and%20Mistress%20Julia%20_thumb_0.jpg) (http://pimpandhost.com/image/58500105-original.html)

Download Links:

Hot facesitting 4 Mistress Katya and Mistress Julia .rar (http://k2s.cc/file/6ea588eaf9a1e)
Title: Hot facesitting 4 Mistresses Dasha
Post by: squidmanheis on November 20, 2016, 01:30:16 pm
Hot facesitting 4 Mistresses Dasha

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/y/3XsyW/Hot%20facesitting%204%20Mistresses%20Dasha%20_cover.jpg) (http://pimpandhost.com/image/58500158-original.html)

File Name : Hot facesitting 4 Mistresses Dasha
Runtime : 16min 35s
File Size : 252 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/y/3XsyX/Hot%20facesitting%204%20Mistresses%20Dasha%20_thumb_0.jpg) (http://pimpandhost.com/image/58500159-original.html)

Download Links:

Hot facesitting 4 Mistresses Dasha .rar (http://k2s.cc/file/1c4fc21379163)
Title: Hot facesitting 4 Three Sexy Mistresses Part One
Post by: squidmanheis on November 20, 2016, 04:55:15 pm
Hot facesitting 4 Three Sexy Mistresses Part One

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/z/3Xszr/Hot%20facesitting%204%20Three%20Sexy%20Mistresses%20Part%20One%20_cover.jpg) (http://pimpandhost.com/image/58500189-original.html)

File Name : Hot facesitting 4 Three Sexy Mistresses Part One
Runtime : 14min 47s
File Size : 234 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/z/3Xszs/Hot%20facesitting%204%20Three%20Sexy%20Mistresses%20Part%20One%20_thumb_0.jpg) (http://pimpandhost.com/image/58500190-original.html)

Download Links:

Hot facesitting 4 Three Sexy Mistresses Part One .rar (http://k2s.cc/file/e4554cb9ff954)
Title: Hot facesitting 4
Post by: squidmanheis on November 20, 2016, 08:20:15 pm
Hot facesitting 4

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/z/3XszJ/Hot%20facesitting%204_cover.jpg) (http://pimpandhost.com/image/58500207-original.html)

File Name : Hot facesitting 4
Runtime : 17min 47s
File Size : 262 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/z/3XszK/Hot%20facesitting%204_thumb_0.jpg) (http://pimpandhost.com/image/58500208-original.html)

Download Links:

Hot facesitting 4.rar (http://k2s.cc/file/3f199650c5566)
Title: Hot facesitting 5 Goddess Darya
Post by: squidmanheis on November 20, 2016, 11:45:15 pm
Hot facesitting 5 Goddess Darya

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/A/3XsA2/Hot%20facesitting%205%20Goddess%20Darya_cover.jpg) (http://pimpandhost.com/image/58500226-original.html)

File Name : Hot facesitting 5 Goddess Darya
Runtime : 11min 53s
File Size : 177 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/A/3XsA3/Hot%20facesitting%205%20Goddess%20Darya_thumb_0.jpg) (http://pimpandhost.com/image/58500227-original.html)

Download Links:

Hot facesitting 5 Goddess Darya.rar (http://k2s.cc/file/5ca93e14fdb68)
Title: Hot facesitting 5 Goddess Dasha
Post by: squidmanheis on November 21, 2016, 03:10:14 am
Hot facesitting 5 Goddess Dasha

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/A/3XsAd/Hot%20facesitting%205%20Goddess%20Dasha%20_cover.jpg) (http://pimpandhost.com/image/58500237-original.html)

File Name : Hot facesitting 5 Goddess Dasha
Runtime : 14min 13s
File Size : 216 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/A/3XsAe/Hot%20facesitting%205%20Goddess%20Dasha%20_thumb_0.jpg) (http://pimpandhost.com/image/58500238-original.html)

Download Links:

Hot facesitting 5 Goddess Dasha .rar (http://k2s.cc/file/c9a625167719e)
Title: Hot facesitting 5 Goddesses Katya and Ksenya Part One
Post by: squidmanheis on November 21, 2016, 06:35:14 am
Hot facesitting 5 Goddesses Katya and Ksenya Part One

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/A/3XsAO/Hot%20facesitting%205%20Goddesses%20Katya%20and%20Ksenya%20Part%20One_cover.jpg) (http://pimpandhost.com/image/58500274-original.html)

File Name : Hot facesitting 5 Goddesses Katya and Ksenya Part One
Runtime : 15min 38s
File Size : 248 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/A/3XsAP/Hot%20facesitting%205%20Goddesses%20Katya%20and%20Ksenya%20Part%20One_thumb_0.jpg) (http://pimpandhost.com/image/58500275-original.html)

Download Links:

Hot facesitting 5 Goddesses Katya and Ksenya Part One.rar (http://k2s.cc/file/16d2c29031651)
Title: Hot facesitting 5 Mistress Anna
Post by: squidmanheis on November 21, 2016, 10:00:14 am
Hot facesitting 5 Mistress Anna

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/B/3XsBg/Hot%20facesitting%205%20Mistress%20Anna%20_cover.jpg) (http://pimpandhost.com/image/58500302-original.html)

File Name : Hot facesitting 5 Mistress Anna
Runtime : 12min 58s
File Size : 196 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/B/3XsBh/Hot%20facesitting%205%20Mistress%20Anna%20_thumb_0.jpg) (http://pimpandhost.com/image/58500303-original.html)

Download Links:

Hot facesitting 5 Mistress Anna .rar (http://k2s.cc/file/16325ff0f3dc0)
Title: Hot facesitting 5
Post by: squidmanheis on November 21, 2016, 01:25:04 pm
Hot facesitting 5

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/D/3XsDk/Hot%20facesitting%205_cover.jpg) (http://pimpandhost.com/image/58500430-original.html)

File Name : Hot facesitting 5
Runtime : 14min 38s
File Size : 336 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/D/3XsDl/Hot%20facesitting%205_thumb_0.jpg) (http://pimpandhost.com/image/58500431-original.html)

Download Links:

Hot facesitting 5.rar (http://k2s.cc/file/b932fee1939d8)
Title: Hot facesitting 6 Goddess Anna
Post by: squidmanheis on November 21, 2016, 04:50:04 pm
Hot facesitting 6 Goddess Anna

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/D/3XsDF/Hot%20facesitting%206%20Goddess%20Anna%20_cover.jpg) (http://pimpandhost.com/image/58500451-original.html)

File Name : Hot facesitting 6 Goddess Anna
Runtime : 14min 39s
File Size : 222 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/D/3XsDG/Hot%20facesitting%206%20Goddess%20Anna%20_thumb_0.jpg) (http://pimpandhost.com/image/58500452-original.html)

Download Links:

Hot facesitting 6 Goddess Anna .rar (http://k2s.cc/file/5f255a5ef4e47)
Title: Hot facesitting 6 Goddesses Lana and Julia
Post by: squidmanheis on November 21, 2016, 08:15:13 pm
Hot facesitting 6 Goddesses Lana and Julia

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/E/3XsE9/Hot%20facesitting%206%20Goddesses%20Lana%20and%20Julia%20_cover.jpg) (http://pimpandhost.com/image/58500481-original.html)

File Name : Hot facesitting 6 Goddesses Lana and Julia
Runtime : 13min 29s
File Size : 200 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/E/3XsEa/Hot%20facesitting%206%20Goddesses%20Lana%20and%20Julia%20_thumb_0.jpg) (http://pimpandhost.com/image/58500482-original.html)

Download Links:

Hot facesitting 6 Goddesses Lana and Julia .rar (http://k2s.cc/file/49aa9bebb9a53)
Title: Hot facesitting 6 Mistress Dasha
Post by: squidmanheis on November 21, 2016, 11:40:12 pm
Hot facesitting 6 Mistress Dasha

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/E/3XsEq/Hot%20facesitting%206%20Mistress%20Dasha%20_cover.jpg) (http://pimpandhost.com/image/58500498-original.html)

File Name : Hot facesitting 6 Mistress Dasha
Runtime : 15min 28s
File Size : 233 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/E/3XsEs/Hot%20facesitting%206%20Mistress%20Dasha%20_thumb_0.jpg) (http://pimpandhost.com/image/58500500-original.html)

Download Links:

Hot facesitting 6 Mistress Dasha .rar (http://k2s.cc/file/5714e048de2a0)
Title: Hot facesitting 6 Three Sexy Mistresses Part Two
Post by: squidmanheis on November 22, 2016, 04:06:53 am
Hot facesitting 6 Three Sexy Mistresses Part Two

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/F/3XsF4/Hot%20facesitting%206%20Three%20Sexy%20Mistresses%20Part%20Two%20_cover.jpg) (http://pimpandhost.com/image/58500538-original.html)

File Name : Hot facesitting 6 Three Sexy Mistresses Part Two
Runtime : 13min 38s
File Size : 216 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/F/3XsF5/Hot%20facesitting%206%20Three%20Sexy%20Mistresses%20Part%20Two%20_thumb_0.jpg) (http://pimpandhost.com/image/58500539-original.html)

Download Links:

Hot facesitting 6 Three Sexy Mistresses Part Two .rar (http://k2s.cc/file/ca8ff20947713)
Title: Hot facesitting 6
Post by: squidmanheis on November 22, 2016, 06:30:21 am
Hot facesitting 6

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/F/3XsFJ/Hot%20facesitting%206_cover.jpg) (http://pimpandhost.com/image/58500579-original.html)

File Name : Hot facesitting 6
Runtime : 13min 44s
File Size : 315 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/F/3XsFM/Hot%20facesitting%206_thumb_0.jpg) (http://pimpandhost.com/image/58500582-original.html)

Download Links:

Hot facesitting 6.rar (http://k2s.cc/file/6fcda88fe7b24)
Title: Hot facesitting 7 Goddesses Alexandra and Dasha
Post by: squidmanheis on November 22, 2016, 09:55:11 am
Hot facesitting 7 Goddesses Alexandra and Dasha

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/G/3XsGh/Hot%20facesitting%207%20Goddesses%20Alexandra%20and%20Dasha%20_cover.jpg) (http://pimpandhost.com/image/58500613-original.html)

File Name : Hot facesitting 7 Goddesses Alexandra and Dasha
Runtime : 12min 34s
File Size : 191 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/G/3XsGj/Hot%20facesitting%207%20Goddesses%20Alexandra%20and%20Dasha%20_thumb_0.jpg) (http://pimpandhost.com/image/58500615-original.html)

Download Links:

Hot facesitting 7 Goddesses Alexandra and Dasha .rar (http://k2s.cc/file/746deb8e19a35)
Title: Hot facesitting 7 Pretty Young Goddess Liza
Post by: squidmanheis on November 22, 2016, 06:20:50 pm
Hot facesitting 7 Pretty Young Goddess Liza

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/I/3XsI2/Hot%20facesitting%207%20Pretty%20Young%20Goddess%20Liza_cover.jpg) (http://pimpandhost.com/image/58500722-original.html)

File Name : Hot facesitting 7 Pretty Young Goddess Liza
Runtime : 13min 2s
File Size : 207 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/I/3XsI4/Hot%20facesitting%207%20Pretty%20Young%20Goddess%20Liza_thumb_0.jpg) (http://pimpandhost.com/image/58500724-original.html)

Download Links:

Hot facesitting 7 Pretty Young Goddess Liza.rar (http://k2s.cc/file/474466e45b46a)
Title: Hot facesitting 7 Mistresses Alesya and Annya
Post by: squidmanheis on November 22, 2016, 06:46:06 pm
Hot facesitting 7 Mistresses Alesya and Annya

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/G/3XsGK/Hot%20facesitting%207%20Mistresses%20Alesya%20and%20Annya%20_cover.jpg) (http://pimpandhost.com/image/58500642-original.html)

File Name : Hot facesitting 7 Mistresses Alesya and Annya
Runtime : 18min 15s
File Size : 275 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/G/3XsGN/Hot%20facesitting%207%20Mistresses%20Alesya%20and%20Annya%20_thumb_0.jpg) (http://pimpandhost.com/image/58500645-original.html)

Download Links:

Hot facesitting 7 Mistresses Alesya and Annya .rar (http://k2s.cc/file/7d633eaa0717d)
Title: Hot facesitting 7
Post by: squidmanheis on November 22, 2016, 08:10:17 pm
Hot facesitting 7

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/J/3XsJ8/Hot%20facesitting%207_cover.jpg) (http://pimpandhost.com/image/58500790-original.html)

File Name : Hot facesitting 7
Runtime : 11min 47s
File Size : 280 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/J/3XsJd/Hot%20facesitting%207_thumb_0.jpg) (http://pimpandhost.com/image/58500795-original.html)

Download Links:

Hot facesitting 7.rar (http://k2s.cc/file/8f0e692f77e6a)
Title: Hot facesitting 8 Goddess Natalya
Post by: squidmanheis on November 22, 2016, 11:35:18 pm
Hot facesitting 8 Goddess Natalya

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/K/3XsKP/Hot%20facesitting%208%20Goddess%20Natalya%20_cover.jpg) (http://pimpandhost.com/image/58500895-original.html)

File Name : Hot facesitting 8 Goddess Natalya
Runtime : 12min 39s
File Size : 192 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/K/3XsKQ/Hot%20facesitting%208%20Goddess%20Natalya%20_thumb_0.jpg) (http://pimpandhost.com/image/58500896-original.html)

Download Links:

Hot facesitting 8 Goddess Natalya .rar (http://k2s.cc/file/69b8a53b7d741)
Title: Hot facesitting 8 Goddesses Katya and Ksenya Part Two
Post by: squidmanheis on November 23, 2016, 03:00:18 am
Hot facesitting 8 Goddesses Katya and Ksenya Part Two

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/L/3XsL8/Hot%20facesitting%208%20Goddesses%20Katya%20and%20Ksenya%20Part%20Two_cover.jpg) (http://pimpandhost.com/image/58500914-original.html)

File Name : Hot facesitting 8 Goddesses Katya and Ksenya Part Two
Runtime : 13min 47s
File Size : 218 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/L/3XsL9/Hot%20facesitting%208%20Goddesses%20Katya%20and%20Ksenya%20Part%20Two_thumb_0.jpg) (http://pimpandhost.com/image/58500915-original.html)

Download Links:

Hot facesitting 8 Goddesses Katya and Ksenya Part Two.rar (http://k2s.cc/file/31a1575781fd8)
Title: Hot facesitting 8 Mistress Julia and Mistress Dasha
Post by: squidmanheis on November 23, 2016, 06:25:18 am
Hot facesitting 8 Mistress Julia and Mistress Dasha

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/L/3XsLi/Hot%20facesitting%208%20Mistress%20Julia%20and%20Mistress%20Dasha_cover.jpg) (http://pimpandhost.com/image/58500924-original.html)

File Name : Hot facesitting 8 Mistress Julia and Mistress Dasha
Runtime : 14min 40s
File Size : 169 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/L/3XsLj/Hot%20facesitting%208%20Mistress%20Julia%20and%20Mistress%20Dasha_thumb_0.jpg) (http://pimpandhost.com/image/58500925-original.html)

Download Links:

Hot facesitting 8 Mistress Julia and Mistress Dasha.rar (http://k2s.cc/file/582e6a28a99f8)
Title: Hot facesitting 8 Two Mistresses and slave
Post by: squidmanheis on November 23, 2016, 09:50:15 am
Hot facesitting 8 Two Mistresses and slave

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/L/3XsLw/Hot%20facesitting%208%20Two%20Mistresses%20and%20slave_cover.jpg) (http://pimpandhost.com/image/58500938-original.html)

File Name : Hot facesitting 8 Two Mistresses and slave
Runtime : 12min 53s
File Size : 196 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/L/3XsLx/Hot%20facesitting%208%20Two%20Mistresses%20and%20slave_thumb_0.jpg) (http://pimpandhost.com/image/58500939-original.html)

Download Links:

Hot facesitting 8 Two Mistresses and slave.rar (http://k2s.cc/file/4c09a608ebfd0)
Title: Hot facesitting 8
Post by: squidmanheis on November 23, 2016, 01:15:16 pm
Hot facesitting 8

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/N/3XsNe/Hot%20facesitting%208_cover.jpg) (http://pimpandhost.com/image/58501044-original.html)

File Name : Hot facesitting 8
Runtime : 12min 51s
File Size : 304 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/N/3XsNj/Hot%20facesitting%208_thumb_0.jpg) (http://pimpandhost.com/image/58501049-original.html)

Download Links:

Hot facesitting 8.rar (http://k2s.cc/file/922c1ea07adcb)
Title: Hot facesitting 9 Goddesses Lera Aina
Post by: squidmanheis on November 23, 2016, 04:40:13 pm
Hot facesitting 9 Goddesses Lera   Aina

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/O/3XsOp/Hot%20facesitting%209%20Goddesses%20Lera%20%20%20Aina%20_cover.jpg) (http://pimpandhost.com/image/58501117-original.html)

File Name : Hot facesitting 9 Goddesses Lera   Aina
Runtime : 13min 27s
File Size : 212 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/O/3XsOq/Hot%20facesitting%209%20Goddesses%20Lera%20%20%20Aina%20_thumb_0.jpg) (http://pimpandhost.com/image/58501118-original.html)

Download Links:

Hot facesitting 9 Goddesses Lera   Aina .rar (http://k2s.cc/file/f62759f58a6b9)
Title: Hot facesitting 9 Mistress Julia
Post by: squidmanheis on November 23, 2016, 08:05:14 pm
Hot facesitting 9 Mistress Julia

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/O/3XsOy/Hot%20facesitting%209%20Mistress%20Julia_cover.jpg) (http://pimpandhost.com/image/58501126-original.html)

File Name : Hot facesitting 9 Mistress Julia
Runtime : 12min 24s
File Size : 184 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/O/3XsOA/Hot%20facesitting%209%20Mistress%20Julia_thumb_0.jpg) (http://pimpandhost.com/image/58501128-original.html)

Download Links:

Hot facesitting 9 Mistress Julia.rar (http://k2s.cc/file/04215363fbe21)
Title: Hot facesitting 9 Mistress Olga
Post by: squidmanheis on November 23, 2016, 11:30:13 pm
Hot facesitting 9 Mistress Olga

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/O/3XsOQ/Hot%20facesitting%209%20Mistress%20Olga%20_cover.jpg) (http://pimpandhost.com/image/58501144-original.html)

File Name : Hot facesitting 9 Mistress Olga
Runtime : 13min 24s
File Size : 204 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/O/3XsOS/Hot%20facesitting%209%20Mistress%20Olga%20_thumb_0.jpg) (http://pimpandhost.com/image/58501146-original.html)

Download Links:

Hot facesitting 9 Mistress Olga .rar (http://k2s.cc/file/b9fd2d4b741b3)
Title: Hot facesitting 9 Mistress Viki
Post by: squidmanheis on November 24, 2016, 02:55:14 am
Hot facesitting 9 Mistress Viki

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/P/3XsP3/Hot%20facesitting%209%20Mistress%20Viki_cover.jpg) (http://pimpandhost.com/image/58501157-original.html)

File Name : Hot facesitting 9 Mistress Viki
Runtime : 14min 11s
File Size : 224 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/P/3XsP4/Hot%20facesitting%209%20Mistress%20Viki_thumb_0.jpg) (http://pimpandhost.com/image/58501158-original.html)

Download Links:

Hot facesitting 9 Mistress Viki.rar (http://k2s.cc/file/f3ca19ef6f674)
Title: Hot facesitting 9
Post by: squidmanheis on November 24, 2016, 06:20:13 am
Hot facesitting 9

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/P/3XsPr/Hot%20facesitting%209_cover.jpg) (http://pimpandhost.com/image/58501181-original.html)

File Name : Hot facesitting 9
Runtime : 13min 52s
File Size : 330 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/P/3XsPs/Hot%20facesitting%209_thumb_0.jpg) (http://pimpandhost.com/image/58501182-original.html)

Download Links:

Hot facesitting 9.rar (http://k2s.cc/file/5e2aedaae2463)
Title: Smother 088a Andrea Devin
Post by: squidmanheis on November 24, 2016, 09:45:12 am
Smother 088a - Andrea   Devin

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/R/3XsRu/Smother%20088a%20-%20Andrea%20%20%20Devin_cover.jpg) (http://pimpandhost.com/image/58501308-original.html)

File Name : Smother 088a - Andrea   Devin
Runtime : 29min 58s
File Size : 231 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/R/3XsRD/Smother%20088a%20-%20Andrea%20%20%20Devin_thumb_0.jpg) (http://pimpandhost.com/image/58501317-original.html)

Download Links:

Smother 088a - Andrea   Devin.rar (http://k2s.cc/file/c52e03ffc9e35)
Title: Smother 112a Andrea Devin
Post by: squidmanheis on November 24, 2016, 01:10:10 pm
Smother 112a - Andrea   Devin

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/Y/3XsYV/Smother%20112a%20-%20Andrea%20%20%20Devin_cover.jpg) (http://pimpandhost.com/image/58501769-original.html)

File Name : Smother 112a - Andrea   Devin
Runtime : 29min 22s
File Size : 229 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/Z/3XsZ2/Smother%20112a%20-%20Andrea%20%20%20Devin_thumb_0.jpg) (http://pimpandhost.com/image/58501776-original.html)

Download Links:

Smother 112a - Andrea   Devin.rar (http://k2s.cc/file/61d87d667399c)
Title: Smother 129a Molina Nancy
Post by: squidmanheis on November 24, 2016, 04:35:12 pm
Smother 129a - Molina   Nancy

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/6/3Xt6a/Smother%20129a%20-%20Molina%20%20%20Nancy_cover.jpg) (http://pimpandhost.com/image/58502218-original.html)

File Name : Smother 129a - Molina   Nancy
Runtime : 30min 43s
File Size : 224 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/6/3Xt6l/Smother%20129a%20-%20Molina%20%20%20Nancy_thumb_0.jpg) (http://pimpandhost.com/image/58502229-original.html)

Download Links:

Smother 129a - Molina   Nancy.rar (http://k2s.cc/file/22b7d77ca9fb5)
Title: Smother 142b
Post by: squidmanheis on November 24, 2016, 08:00:10 pm
Smother 142b

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/f/3Xtf2/Smother%20142b_cover.jpg) (http://pimpandhost.com/image/58502768-original.html)

File Name : Smother 142b
Runtime : 10min 20s
File Size : 99.5 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/f/3Xtfa/Smother%20142b_thumb_0.jpg) (http://pimpandhost.com/image/58502776-original.html)

Download Links:

Smother 142b.rar (http://k2s.cc/file/dd2f05a58ff64)
Title: Smother 147b Andrea Jaimee
Post by: squidmanheis on November 24, 2016, 11:25:33 pm
Smother 147b - Andrea   Jaimee

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/i/3Xtik/Smother%20147b%20-%20Andrea%20%20%20Jaimee_cover.jpg) (http://pimpandhost.com/image/58502972-original.html)

File Name : Smother 147b - Andrea   Jaimee
Runtime : 25min 50s
File Size : 219 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/i/3Xtis/Smother%20147b%20-%20Andrea%20%20%20Jaimee_thumb_0.jpg) (http://pimpandhost.com/image/58502980-original.html)

Download Links:

Smother 147b - Andrea   Jaimee.rar (http://k2s.cc/file/2564b6a25fc3a)
Title: Smother 147b Andrea Jaimee
Post by: squidmanheis on November 24, 2016, 11:26:11 pm
Smother 147b - Andrea   Jaimee

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/i/3Xtik/Smother%20147b%20-%20Andrea%20%20%20Jaimee_cover.jpg) (http://pimpandhost.com/image/58502972-original.html)

File Name : Smother 147b - Andrea   Jaimee
Runtime : 25min 50s
File Size : 219 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/i/3Xtis/Smother%20147b%20-%20Andrea%20%20%20Jaimee_thumb_0.jpg) (http://pimpandhost.com/image/58502980-original.html)

Download Links:

Smother 147b - Andrea   Jaimee.rar (http://k2s.cc/file/2564b6a25fc3a)
Title: Smother 202
Post by: squidmanheis on November 25, 2016, 02:50:07 am
Smother 202

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/p/3XtpE/Smother%20202_cover.jpg) (http://pimpandhost.com/image/58503426-original.html)

File Name : Smother 202
Runtime : 5min 35s
File Size : 60.7 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/p/3XtpO/Smother%20202_thumb_0.jpg) (http://pimpandhost.com/image/58503436-original.html)

Download Links:

Smother 202.rar (http://k2s.cc/file/2b43586a88462)
Title: Smother 208
Post by: squidmanheis on November 25, 2016, 06:15:07 am
Smother 208

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/r/3XtrK/Smother%20208_cover.jpg) (http://pimpandhost.com/image/58503556-original.html)

File Name : Smother 208
Runtime : 9min 34s
File Size : 119 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/r/3XtrT/Smother%20208_thumb_0.jpg) (http://pimpandhost.com/image/58503565-original.html)

Download Links:

Smother 208.rar (http://k2s.cc/file/03c05ac70d231)
Title: Smother 214
Post by: squidmanheis on November 25, 2016, 09:40:05 am
Smother 214

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/v/3Xtvj/Smother%20214_cover.jpg) (http://pimpandhost.com/image/58503777-original.html)

File Name : Smother 214
Runtime : 6min 35s
File Size : 71.7 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/v/3Xtvs/Smother%20214_thumb_0.jpg) (http://pimpandhost.com/image/58503786-original.html)

Download Links:

Smother 214.rar (http://k2s.cc/file/cdb300cc50816)
Title: Smother 217
Post by: squidmanheis on November 25, 2016, 01:05:05 pm
Smother 217

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/x/3XtxJ/Smother%20217_cover.jpg) (http://pimpandhost.com/image/58503927-original.html)

File Name : Smother 217
Runtime : 7min 50s
File Size : 74.6 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/x/3XtxR/Smother%20217_thumb_0.jpg) (http://pimpandhost.com/image/58503935-original.html)

Download Links:

Smother 217.rar (http://k2s.cc/file/4ccceee5c598f)
Title: Smother 220
Post by: squidmanheis on November 25, 2016, 04:30:03 pm
Smother 220

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/A/3XtA9/Smother%20220_cover.jpg) (http://pimpandhost.com/image/58504077-original.html)

File Name : Smother 220
Runtime : 6min 0s
File Size : 53.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/A/3XtAh/Smother%20220_thumb_0.jpg) (http://pimpandhost.com/image/58504085-original.html)

Download Links:

Smother 220.rar (http://k2s.cc/file/4d19abd2db225)
Title: Smother 223
Post by: squidmanheis on November 25, 2016, 07:55:05 pm
Smother 223

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/B/3XtBR/Smother%20223_cover.jpg) (http://pimpandhost.com/image/58504183-original.html)

File Name : Smother 223
Runtime : 6min 0s
File Size : 58.2 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/C/3XtC0/Smother%20223_thumb_0.jpg) (http://pimpandhost.com/image/58504192-original.html)

Download Links:

Smother 223.rar (http://k2s.cc/file/683477524f86d)
Title: Smother 224
Post by: squidmanheis on November 25, 2016, 11:20:02 pm
Smother 224

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/D/3XtDT/Smother%20224_cover.jpg) (http://pimpandhost.com/image/58504309-original.html)

File Name : Smother 224
Runtime : 6min 0s
File Size : 59.9 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/E/3XtE4/Smother%20224_thumb_0.jpg) (http://pimpandhost.com/image/58504320-original.html)

Download Links:

Smother 224.rar (http://k2s.cc/file/f5c0596f4b4a2)
Title: Smother 225
Post by: squidmanheis on November 26, 2016, 02:44:54 am
Smother 225

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/G/3XtG1/Smother%20225_cover.jpg) (http://pimpandhost.com/image/58504441-original.html)

File Name : Smother 225
Runtime : 6min 20s
File Size : 74.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/G/3XtG9/Smother%20225_thumb_0.jpg) (http://pimpandhost.com/image/58504449-original.html)

Download Links:

Smother 225.rar (http://k2s.cc/file/17243e1dd2e88)
Title: Smother 229
Post by: squidmanheis on November 26, 2016, 06:10:04 am
Smother 229

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/I/3XtIw/Smother%20229_cover.jpg) (http://pimpandhost.com/image/58504596-original.html)

File Name : Smother 229
Runtime : 5min 45s
File Size : 48.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/I/3XtIE/Smother%20229_thumb_0.jpg) (http://pimpandhost.com/image/58504604-original.html)

Download Links:

Smother 229.rar (http://k2s.cc/file/4e169d01930eb)
Title: Smother 233
Post by: squidmanheis on November 26, 2016, 09:35:07 am
Smother 233

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/K/3XtKd/Smother%20233_cover.jpg) (http://pimpandhost.com/image/58504701-original.html)

File Name : Smother 233
Runtime : 5min 19s
File Size : 48.6 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/K/3XtKl/Smother%20233_thumb_0.jpg) (http://pimpandhost.com/image/58504709-original.html)

Download Links:

Smother 233.rar (http://k2s.cc/file/d7bdc6200b123)
Title: Smother 234
Post by: squidmanheis on November 26, 2016, 01:00:03 pm
Smother 234

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/L/3XtLX/Smother%20234_cover.jpg) (http://pimpandhost.com/image/58504809-original.html)

File Name : Smother 234
Runtime : 6min 5s
File Size : 59.9 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/M/3XtM4/Smother%20234_thumb_0.jpg) (http://pimpandhost.com/image/58504816-original.html)

Download Links:

Smother 234.rar (http://k2s.cc/file/75dba2bc6ced9)
Title: Smother 238
Post by: squidmanheis on November 26, 2016, 04:25:00 pm
Smother 238

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/O/3XtO5/Smother%20238_cover.jpg) (http://pimpandhost.com/image/58504941-original.html)

File Name : Smother 238
Runtime : 6min 15s
File Size : 69.0 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/O/3XtOe/Smother%20238_thumb_0.jpg) (http://pimpandhost.com/image/58504950-original.html)

Download Links:

Smother 238.rar (http://k2s.cc/file/4ca20ac045de8)
Title: Smother 242
Post by: squidmanheis on November 26, 2016, 07:50:00 pm
Smother 242

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/Q/3XtQn/Smother%20242_cover.jpg) (http://pimpandhost.com/image/58505083-original.html)

File Name : Smother 242
Runtime : 6min 40s
File Size : 59.0 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/Q/3XtQD/Smother%20242_thumb_0.jpg) (http://pimpandhost.com/image/58505099-original.html)

Download Links:

Smother 242.rar (http://k2s.cc/file/ab463c8ea11e1)
Title: Smother 244
Post by: squidmanheis on November 26, 2016, 11:14:59 pm
Smother 244

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/T/3XtTp/Smother%20244_cover.jpg) (http://pimpandhost.com/image/58505271-original.html)

File Name : Smother 244
Runtime : 5min 15s
File Size : 47.0 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/T/3XtTx/Smother%20244_thumb_0.jpg) (http://pimpandhost.com/image/58505279-original.html)

Download Links:

Smother 244.rar (http://k2s.cc/file/80e01983e1cb8)
Title: Smother 245
Post by: squidmanheis on November 27, 2016, 02:40:00 am
Smother 245

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/V/3XtVZ/Smother%20245_cover.jpg) (http://pimpandhost.com/image/58505431-original.html)

File Name : Smother 245
Runtime : 5min 20s
File Size : 53.1 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/W/3XtWp/Smother%20245_thumb_0.jpg) (http://pimpandhost.com/image/58505457-original.html)

Download Links:

Smother 245.rar (http://k2s.cc/file/844e78fc68504)
Title: Smother 247
Post by: squidmanheis on November 27, 2016, 06:04:57 am
Smother 247

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/1/3Xu1n/Smother%20247_cover.jpg) (http://pimpandhost.com/image/58505765-original.html)

File Name : Smother 247
Runtime : 5min 35s
File Size : 62.1 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/1/3Xu1K/Smother%20247_thumb_0.jpg) (http://pimpandhost.com/image/58505788-original.html)

Download Links:

Smother 247.rar (http://k2s.cc/file/872908f6926bf)
Title: Smother 256
Post by: squidmanheis on November 27, 2016, 09:29:59 am
Smother 256

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/7/3Xu7d/Smother%20256_cover.jpg) (http://pimpandhost.com/image/58506127-original.html)

File Name : Smother 256
Runtime : 5min 0s
File Size : 58.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/7/3Xu7m/Smother%20256_thumb_0.jpg) (http://pimpandhost.com/image/58506136-original.html)

Download Links:

Smother 256.rar (http://k2s.cc/file/c376fa952d718)
Title: Smother 257
Post by: squidmanheis on November 27, 2016, 12:54:56 pm
Smother 257

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/9/3Xu9a/Smother%20257_cover.jpg) (http://pimpandhost.com/image/58506248-original.html)

File Name : Smother 257
Runtime : 5min 10s
File Size : 53.9 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/9/3Xu9j/Smother%20257_thumb_0.jpg) (http://pimpandhost.com/image/58506257-original.html)

Download Links:

Smother 257.rar (http://k2s.cc/file/4752bbfb931ab)
Title: Smother 258
Post by: squidmanheis on November 27, 2016, 04:19:56 pm
Smother 258

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/b/3XubM/Smother%20258_cover.jpg) (http://pimpandhost.com/image/58506410-original.html)

File Name : Smother 258
Runtime : 4min 55s
File Size : 53.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/c/3Xucd/Smother%20258_thumb_0.jpg) (http://pimpandhost.com/image/58506437-original.html)

Download Links:

Smother 258.rar (http://k2s.cc/file/c934f1406ff98)
Title: Smother 259
Post by: squidmanheis on November 27, 2016, 07:44:54 pm
Smother 259

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/f/3Xuf0/Smother%20259_cover.jpg) (http://pimpandhost.com/image/58506610-original.html)

File Name : Smother 259
Runtime : 7min 15s
File Size : 73.0 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/f/3Xufc/Smother%20259_thumb_0.jpg) (http://pimpandhost.com/image/58506622-original.html)

Download Links:

Smother 259.rar (http://k2s.cc/file/8443c5c7dccf1)
Title: Smother 260
Post by: squidmanheis on November 27, 2016, 11:09:55 pm
Smother 260

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/h/3XuhD/Smother%20260_cover.jpg) (http://pimpandhost.com/image/58506773-original.html)

File Name : Smother 260
Runtime : 5min 40s
File Size : 59.5 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/h/3XuhP/Smother%20260_thumb_0.jpg) (http://pimpandhost.com/image/58506785-original.html)

Download Links:

Smother 260.rar (http://k2s.cc/file/24bfbc38a1eca)
Title: Smother 268
Post by: squidmanheis on November 28, 2016, 02:34:53 am
Smother 268

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/j/3XujH/Smother%20268_cover.jpg) (http://pimpandhost.com/image/58506901-original.html)

File Name : Smother 268
Runtime : 8min 59s
File Size : 100 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/j/3XujP/Smother%20268_thumb_0.jpg) (http://pimpandhost.com/image/58506909-original.html)

Download Links:

Smother 268.rar (http://k2s.cc/file/f865c44aa9f7d)
Title: Smother 310 Melony
Post by: squidmanheis on November 28, 2016, 05:59:52 am
Smother 310 - Melony

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/m/3Xumx/Smother%20310%20-%20Melony_cover.jpg) (http://pimpandhost.com/image/58507077-original.html)

File Name : Smother 310 - Melony
Runtime : 11min 22s
File Size : 106 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/m/3XumC/Smother%20310%20-%20Melony_thumb_0.jpg) (http://pimpandhost.com/image/58507082-original.html)

Download Links:

Smother 310 - Melony.rar (http://k2s.cc/file/ed6ba793f296b)
Title: Smother 311 Melony
Post by: squidmanheis on November 28, 2016, 09:24:54 am
Smother 311 - Melony

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/o/3XuoE/Smother%20311%20-%20Melony_cover.jpg) (http://pimpandhost.com/image/58507208-original.html)

File Name : Smother 311 - Melony
Runtime : 14min 51s
File Size : 117 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/o/3XuoJ/Smother%20311%20-%20Melony_thumb_0.jpg) (http://pimpandhost.com/image/58507213-original.html)

Download Links:

Smother 311 - Melony.rar (http://k2s.cc/file/34de89134f4d4)
Title: Smother 312 Melony
Post by: squidmanheis on November 28, 2016, 12:50:53 pm
Smother 312 - Melony

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/q/3XuqC/Smother%20312%20-%20Melony_cover.jpg) (http://pimpandhost.com/image/58507330-original.html)

File Name : Smother 312 - Melony
Runtime : 17min 24s
File Size : 175 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/q/3XuqH/Smother%20312%20-%20Melony_thumb_0.jpg) (http://pimpandhost.com/image/58507335-original.html)

Download Links:

Smother 312 - Melony.rar (http://k2s.cc/file/6520e2d3ff3f5)
Title: Smother 313 Melony
Post by: squidmanheis on November 28, 2016, 04:15:49 pm
Smother 313 - Melony

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/t/3Xutm/Smother%20313%20-%20Melony_cover.jpg) (http://pimpandhost.com/image/58507500-original.html)

File Name : Smother 313 - Melony
Runtime : 9min 45s
File Size : 78.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/t/3Xutq/Smother%20313%20-%20Melony_thumb_0.jpg) (http://pimpandhost.com/image/58507504-original.html)

Download Links:

Smother 313 - Melony.rar (http://k2s.cc/file/ba0ed5d588c74)
Title: Smother 317
Post by: squidmanheis on November 28, 2016, 07:40:52 pm
Smother 317

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/v/3XuvU/Smother%20317_cover.jpg) (http://pimpandhost.com/image/58507658-original.html)

File Name : Smother 317
Runtime : 10min 43s
File Size : 92.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/w/3Xuw2/Smother%20317_thumb_0.jpg) (http://pimpandhost.com/image/58507666-original.html)

Download Links:

Smother 317.rar (http://k2s.cc/file/cb313b67dedf8)
Title: Smother 318
Post by: squidmanheis on November 28, 2016, 11:05:50 pm
Smother 318

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/y/3Xuyi/Smother%20318_cover.jpg) (http://pimpandhost.com/image/58507806-original.html)

File Name : Smother 318
Runtime : 11min 50s
File Size : 124 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/y/3Xuyq/Smother%20318_thumb_0.jpg) (http://pimpandhost.com/image/58507814-original.html)

Download Links:

Smother 318.rar (http://k2s.cc/file/89e4e5c5f4ad4)
Title: Smother 323
Post by: squidmanheis on November 29, 2016, 02:30:52 am
Smother 323

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/y/3XuyO/Smother%20323_cover.jpg) (http://pimpandhost.com/image/58507838-original.html)

File Name : Smother 323
Runtime : 11min 1s
File Size : 115 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/y/3XuyP/Smother%20323_thumb_0.jpg) (http://pimpandhost.com/image/58507839-original.html)

Download Links:

Smother 323.rar (http://k2s.cc/file/b858e84b9e729)
Title: Smother 327
Post by: squidmanheis on November 29, 2016, 05:55:51 am
Smother 327

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/z/3Xuzx/Smother%20327_cover.jpg) (http://pimpandhost.com/image/58507883-original.html)

File Name : Smother 327
Runtime : 9min 42s
File Size : 104 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/z/3XuzD/Smother%20327_thumb_0.jpg) (http://pimpandhost.com/image/58507889-original.html)

Download Links:

Smother 327.rar (http://k2s.cc/file/c9c370f4bf136)
Title: Smother 328
Post by: squidmanheis on November 29, 2016, 09:20:41 am
Smother 328

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/B/3XuBa/Smother%20328_cover.jpg) (http://pimpandhost.com/image/58507984-original.html)

File Name : Smother 328
Runtime : 9min 49s
File Size : 112 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/u/B/3XuBb/Smother%20328_thumb_0.jpg) (http://pimpandhost.com/image/58507985-original.html)

Download Links:

Smother 328.rar (http://k2s.cc/file/3493e79e04586)
Title: 001 003 anya
Post by: squidmanheis on December 11, 2016, 07:09:37 am
001-003 anya

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/g/3XrgV/001-003%20anya_cover.jpg) (http://pimpandhost.com/image/58495197-original.html)

File Name : 001-003 anya
Runtime : 19min 2s
File Size : 145 MB
File Type: asf
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/g/3XrgY/001-003%20anya_thumb_0.jpg) (http://pimpandhost.com/image/58495200-original.html)

Download Links:

001-003 anya.rar (http://k2s.cc/file/87f2929df5062)
Title: 004 006 alice
Post by: squidmanheis on December 11, 2016, 10:34:58 am
004-006 alice

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/i/3Xrir/004-006%20alice_cover.jpg) (http://pimpandhost.com/image/58495291-original.html)

File Name : 004-006 alice
Runtime : 19min 24s
File Size : 148 MB
File Type: asf
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/i/3Xrit/004-006%20alice_thumb_0.jpg) (http://pimpandhost.com/image/58495293-original.html)

Download Links:

004-006 alice.rar (http://k2s.cc/file/33a3756c350ce)
Title: 007 009 alice tanya
Post by: squidmanheis on December 11, 2016, 01:59:44 pm
007-009 alice tanya

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/j/3Xrj7/007-009%20alice%20tanya_cover.jpg) (http://pimpandhost.com/image/58495333-original.html)

File Name : 007-009 alice tanya
Runtime : 18min 36s
File Size : 142 MB
File Type: asf
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/j/3Xrja/007-009%20alice%20tanya_thumb_0.jpg) (http://pimpandhost.com/image/58495336-original.html)

Download Links:

007-009 alice tanya.rar (http://k2s.cc/file/f89af93eeeac8)
Title: 010 011 zara
Post by: squidmanheis on December 11, 2016, 05:24:42 pm
010-011 zara

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/k/3Xrkj/010-011%20zara_cover.jpg) (http://pimpandhost.com/image/58495407-original.html)

File Name : 010-011 zara
Runtime : 13min 15s
File Size : 101 MB
File Type: asf
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/k/3Xrkk/010-011%20zara_thumb_0.jpg) (http://pimpandhost.com/image/58495408-original.html)

Download Links:

010-011 zara.rar (http://k2s.cc/file/96c93f65a5b57)
Title: 012 014 irina katya
Post by: squidmanheis on December 11, 2016, 08:49:43 pm
012-014 irina katya

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/k/3XrkI/012-014%20irina%20katya_cover.jpg) (http://pimpandhost.com/image/58495432-original.html)

File Name : 012-014 irina katya
Runtime : 17min 56s
File Size : 137 MB
File Type: asf
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/k/3XrkS/012-014%20irina%20katya_thumb_0.jpg) (http://pimpandhost.com/image/58495442-original.html)

Download Links:

012-014 irina katya.rar (http://k2s.cc/file/290c62e952a99)
Title: 015 016 anya arina
Post by: squidmanheis on December 12, 2016, 12:14:38 am
015-016 anya arina

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/l/3Xrlq/015-016%20anya%20arina_cover.jpg) (http://pimpandhost.com/image/58495476-original.html)

File Name : 015-016 anya arina
Runtime : 12min 19s
File Size : 93.8 MB
File Type: asf
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/l/3Xrlr/015-016%20anya%20arina_thumb_0.jpg) (http://pimpandhost.com/image/58495477-original.html)

Download Links:

015-016 anya arina.rar (http://k2s.cc/file/ac98eae52c93d)
Title: 017 019 irina ksusha
Post by: squidmanheis on December 12, 2016, 03:39:57 am
017-019 irina ksusha

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/m/3Xrm1/017-019%20irina%20ksusha_cover.jpg) (http://pimpandhost.com/image/58495513-original.html)

File Name : 017-019 irina ksusha
Runtime : 20min 22s
File Size : 155 MB
File Type: asf
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/m/3Xrm3/017-019%20irina%20ksusha_thumb_0.jpg) (http://pimpandhost.com/image/58495515-original.html)

Download Links:

017-019 irina ksusha.rar (http://k2s.cc/file/a18bddc3b83d7)
Title: 020anna
Post by: squidmanheis on December 12, 2016, 07:04:54 am

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/n/3Xrnq/020anna_cover.jpg) (http://pimpandhost.com/image/58495600-original.html)

File Name : 020anna
Runtime : 6min 0s
File Size : 45.7 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/n/3Xrns/020anna_thumb_0.jpg) (http://pimpandhost.com/image/58495602-original.html)

Download Links:

020anna.rar (http://k2s.cc/file/155d66c155764)
Title: 021anna
Post by: squidmanheis on December 12, 2016, 10:29:47 am

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/n/3XrnG/021anna_cover.jpg) (http://pimpandhost.com/image/58495616-original.html)

File Name : 021anna
Runtime : 3min 0s
File Size : 22.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/n/3XrnH/021anna_thumb_0.jpg) (http://pimpandhost.com/image/58495617-original.html)

Download Links:

021anna.rar (http://k2s.cc/file/ab27af36b6dcf)
Title: 022 anna
Post by: squidmanheis on December 12, 2016, 01:54:47 pm
022 anna

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/n/3XrnL/022%20anna_cover.jpg) (http://pimpandhost.com/image/58495621-original.html)

File Name : 022 anna
Runtime : 8min 29s
File Size : 64.7 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/n/3XrnN/022%20anna_thumb_0.jpg) (http://pimpandhost.com/image/58495623-original.html)

Download Links:

022 anna.rar (http://k2s.cc/file/bbaf5777d8108)
Title: 023 024 tanya lara
Post by: squidmanheis on December 12, 2016, 05:19:45 pm
023-024 tanya lara

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/n/3XrnX/023-024%20tanya%20lara_cover.jpg) (http://pimpandhost.com/image/58495633-original.html)

File Name : 023-024 tanya lara
Runtime : 16min 18s
File Size : 124 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/n/3XrnY/023-024%20tanya%20lara_thumb_0.jpg) (http://pimpandhost.com/image/58495634-original.html)

Download Links:

023-024 tanya lara.rar (http://k2s.cc/file/90fd866a877c4)
Title: 025 026 jenya alice
Post by: squidmanheis on December 12, 2016, 10:28:52 pm
025-026 jenya alice

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/q/3Xrq5/025-026%20jenya%20alice_cover.jpg) (http://pimpandhost.com/image/58495765-original.html)

File Name : 025-026 jenya alice
Runtime : 10min 1s
File Size : 76.4 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/q/3Xrqd/025-026%20jenya%20alice_thumb_0.jpg) (http://pimpandhost.com/image/58495773-original.html)

Download Links:

025-026 jenya alice.rar (http://k2s.cc/file/5f686b565bb5c)
Title: 027 028 anna gold irina
Post by: squidmanheis on December 13, 2016, 12:10:10 am
027-028 anna gold irina

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/q/3Xrqv/027-028%20anna%20gold%20irina_cover.jpg) (http://pimpandhost.com/image/58495791-original.html)

File Name : 027-028 anna gold irina
Runtime : 13min 5s
File Size : 99.6 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/q/3Xrqw/027-028%20anna%20gold%20irina_thumb_0.jpg) (http://pimpandhost.com/image/58495792-original.html)

Download Links:

027-028 anna gold irina.rar (http://k2s.cc/file/e031e46747cde)
Title: 029 031 katya yuliya
Post by: squidmanheis on December 13, 2016, 03:35:09 am
029-031 katya yuliya

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/q/3XrqH/029-031%20katya%20yuliya_cover.jpg) (http://pimpandhost.com/image/58495803-original.html)

File Name : 029-031 katya yuliya
Runtime : 19min 19s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/q/3XrqJ/029-031%20katya%20yuliya_thumb_0.jpg) (http://pimpandhost.com/image/58495805-original.html)

Download Links:

029-031 katya yuliya.rar (http://k2s.cc/file/59276ccf049b9)
Title: 033 034 anya irina
Post by: squidmanheis on December 13, 2016, 07:00:26 am
033-034 anya irina

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/s/3Xrsd/033-034%20anya%20irina_cover.jpg) (http://pimpandhost.com/image/58495897-original.html)

File Name : 033-034 anya irina
Runtime : 14min 45s
File Size : 112 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/s/3Xrsh/033-034%20anya%20irina_thumb_0.jpg) (http://pimpandhost.com/image/58495901-original.html)

Download Links:

033-034 anya irina.rar (http://k2s.cc/file/fad844183841e)
Title: 035 037 anya mara
Post by: squidmanheis on December 13, 2016, 10:25:07 am
035-037 anya mara

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/u/3XruK/035-037%20anya%20mara_cover.jpg) (http://pimpandhost.com/image/58496054-original.html)

File Name : 035-037 anya mara
Runtime : 18min 2s
File Size : 137 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/u/3XruN/035-037%20anya%20mara_thumb_0.jpg) (http://pimpandhost.com/image/58496057-original.html)

Download Links:

035-037 anya mara.rar (http://k2s.cc/file/847c4568db7e5)
Title: 038 039 anya
Post by: squidmanheis on December 13, 2016, 01:50:10 pm
038-039 anya

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/y/3Xryh/038-039%20anya_cover.jpg) (http://pimpandhost.com/image/58496273-original.html)

File Name : 038-039 anya
Runtime : 15min 5s
File Size : 115 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/y/3Xryj/038-039%20anya_thumb_0.jpg) (http://pimpandhost.com/image/58496275-original.html)

Download Links:

038-039 anya.rar (http://k2s.cc/file/e94a0ccf4eff8)
Title: 040 041 katya yuliya
Post by: squidmanheis on December 13, 2016, 05:15:09 pm
040-041 katya yuliya

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/z/3XrzZ/040-041%20katya%20yuliya_cover.jpg) (http://pimpandhost.com/image/58496379-original.html)

File Name : 040-041 katya yuliya
Runtime : 12min 12s
File Size : 92.9 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/A/3XrA2/040-041%20katya%20yuliya_thumb_0.jpg) (http://pimpandhost.com/image/58496382-original.html)

Download Links:

040-041 katya yuliya.rar (http://k2s.cc/file/76c77cb0edbb5)
Title: 043 044 maya
Post by: squidmanheis on December 13, 2016, 08:40:15 pm
043-044 maya

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/E/3XrEh/043-044%20maya_cover.jpg) (http://pimpandhost.com/image/58496645-original.html)

File Name : 043-044 maya
Runtime : 11min 24s
File Size : 86.9 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/E/3XrEt/043-044%20maya_thumb_0.jpg) (http://pimpandhost.com/image/58496657-original.html)

Download Links:

043-044 maya.rar (http://k2s.cc/file/4cc1f6da79ab5)
Title: 054 056 ira tamara
Post by: squidmanheis on December 14, 2016, 12:05:22 am
054-056 ira tamara

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/I/3XrIU/054-056%20ira%20tamara_cover.jpg) (http://pimpandhost.com/image/58496932-original.html)

File Name : 054-056 ira tamara
Runtime : 18min 20s
File Size : 137 MB
File Type: wmv
Resolution : 320x240

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/I/3XrIX/054-056%20ira%20tamara_thumb_0.jpg) (http://pimpandhost.com/image/58496935-original.html)

Download Links:

054-056 ira tamara.rar (http://k2s.cc/file/6f6d6192eac3b)
Title: 057 059 anna mara
Post by: squidmanheis on December 14, 2016, 03:30:11 am
057-059 anna mara

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/K/3XrKQ/057-059%20anna%20mara_cover.jpg) (http://pimpandhost.com/image/58497052-original.html)

File Name : 057-059 anna mara
Runtime : 19min 22s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/K/3XrKV/057-059%20anna%20mara_thumb_0.jpg) (http://pimpandhost.com/image/58497057-original.html)

Download Links:

057-059 anna mara.rar (http://k2s.cc/file/309239c2ba345)
Title: 060 062 maya lisa
Post by: squidmanheis on December 14, 2016, 06:55:10 am
060-062 maya lisa

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/M/3XrMn/060-062%20maya%20lisa_cover.jpg) (http://pimpandhost.com/image/58497147-original.html)

File Name : 060-062 maya lisa
Runtime : 17min 46s
File Size : 135 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/M/3XrMq/060-062%20maya%20lisa_thumb_0.jpg) (http://pimpandhost.com/image/58497150-original.html)

Download Links:

060-062 maya lisa.rar (http://k2s.cc/file/170c6dad463db)
Title: 063 064 irina maya
Post by: squidmanheis on December 14, 2016, 10:20:11 am
063-064 irina maya

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/N/3XrNg/063-064%20irina%20maya_cover.jpg) (http://pimpandhost.com/image/58497202-original.html)

File Name : 063-064 irina maya
Runtime : 15min 23s
File Size : 117 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/N/3XrNj/063-064%20irina%20maya_thumb_0.jpg) (http://pimpandhost.com/image/58497205-original.html)

Download Links:

063-064 irina maya.rar (http://k2s.cc/file/59b7a9227b7a9)
Title: 065 066 tanya
Post by: squidmanheis on December 14, 2016, 01:45:14 pm
065-066 tanya

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/O/3XrOr/065-066%20tanya_cover.jpg) (http://pimpandhost.com/image/58497275-original.html)

File Name : 065-066 tanya
Runtime : 14min 39s
File Size : 112 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/O/3XrOv/065-066%20tanya_thumb_0.jpg) (http://pimpandhost.com/image/58497279-original.html)

Download Links:

065-066 tanya.rar (http://k2s.cc/file/16c80471d9bb9)
Title: 067 068 ira
Post by: squidmanheis on December 14, 2016, 05:10:12 pm
067-068 ira

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/P/3XrPm/067-068%20ira_cover.jpg) (http://pimpandhost.com/image/58497332-original.html)

File Name : 067-068 ira
Runtime : 12min 45s
File Size : 97.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/P/3XrPx/067-068%20ira_thumb_0.jpg) (http://pimpandhost.com/image/58497343-original.html)

Download Links:

067-068 ira.rar (http://k2s.cc/file/4c3ecf8061636)
Title: 069 070 yana
Post by: squidmanheis on December 14, 2016, 08:35:12 pm
069-070 yana

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/Q/3XrQC/069-070%20yana_cover.jpg) (http://pimpandhost.com/image/58497410-original.html)

File Name : 069-070 yana
Runtime : 11min 32s
File Size : 87.9 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/Q/3XrQH/069-070%20yana_thumb_0.jpg) (http://pimpandhost.com/image/58497415-original.html)

Download Links:

069-070 yana.rar (http://k2s.cc/file/a346616e0876d)
Title: 071 073 anna mara
Post by: squidmanheis on December 15, 2016, 12:00:16 am
071-073 anna mara

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/R/3XrRw/071-073%20anna%20mara_cover.jpg) (http://pimpandhost.com/image/58497466-original.html)

File Name : 071-073 anna mara
Runtime : 22min 12s
File Size : 169 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/R/3XrRz/071-073%20anna%20mara_thumb_0.jpg) (http://pimpandhost.com/image/58497469-original.html)

Download Links:

071-073 anna mara.rar (http://k2s.cc/file/be68a3c04a303)
Title: 074 076 ira
Post by: squidmanheis on December 15, 2016, 03:25:15 am
074-076 ira

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/S/3XrSc/074-076%20ira_cover.jpg) (http://pimpandhost.com/image/58497508-original.html)

File Name : 074-076 ira
Runtime : 17min 59s
File Size : 138 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/S/3XrSe/074-076%20ira_thumb_0.jpg) (http://pimpandhost.com/image/58497510-original.html)

Download Links:

074-076 ira.rar (http://k2s.cc/file/6cbdb1c5831fb)
Title: 077 079 ksusha galushko
Post by: squidmanheis on December 15, 2016, 06:50:16 am
077-079 ksusha galushko

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/T/3XrTa/077-079%20ksusha%20galushko_cover.jpg) (http://pimpandhost.com/image/58497568-original.html)

File Name : 077-079 ksusha galushko
Runtime : 18min 0s
File Size : 137 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/T/3XrTe/077-079%20ksusha%20galushko_thumb_0.jpg) (http://pimpandhost.com/image/58497572-original.html)

Download Links:

077-079 ksusha galushko.rar (http://k2s.cc/file/b2f26326a4725)
Title: 080 081 sveta brusser
Post by: squidmanheis on December 15, 2016, 10:15:18 am
080-081 sveta brusser

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/U/3XrUk/080-081%20sveta%20brusser_cover.jpg) (http://pimpandhost.com/image/58497640-original.html)

File Name : 080-081 sveta brusser
Runtime : 15min 35s
File Size : 119 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/U/3XrUl/080-081%20sveta%20brusser_thumb_0.jpg) (http://pimpandhost.com/image/58497641-original.html)

Download Links:

080-081 sveta brusser.rar (http://k2s.cc/file/2b58dc881da42)
Title: 082 084 sveta brusser ksusha galushko
Post by: squidmanheis on December 15, 2016, 01:40:14 pm
082-084 sveta brusser ksusha galushko

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/U/3XrUB/082-084%20sveta%20brusser%20ksusha%20galushko_cover.jpg) (http://pimpandhost.com/image/58497657-original.html)

File Name : 082-084 sveta brusser ksusha galushko
Runtime : 18min 10s
File Size : 139 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/U/3XrUC/082-084%20sveta%20brusser%20ksusha%20galushko_thumb_0.jpg) (http://pimpandhost.com/image/58497658-original.html)

Download Links:

082-084 sveta brusser ksusha galushko.rar (http://k2s.cc/file/812521f49ba7d)
Title: 085 087 sveta brusser pavlik
Post by: squidmanheis on December 15, 2016, 05:05:14 pm
085-087 sveta brusser pavlik

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/V/3XrVc/085-087%20sveta%20brusser%20pavlik_cover.jpg) (http://pimpandhost.com/image/58497694-original.html)

File Name : 085-087 sveta brusser pavlik
Runtime : 18min 8s
File Size : 138 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/V/3XrVf/085-087%20sveta%20brusser%20pavlik_thumb_0.jpg) (http://pimpandhost.com/image/58497697-original.html)

Download Links:

085-087 sveta brusser pavlik.rar (http://k2s.cc/file/e9bf973e86fc1)
Title: 088 089 rita
Post by: squidmanheis on December 15, 2016, 08:30:15 pm
088-089 rita

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/W/3XrWf/088-089%20rita_cover.jpg) (http://pimpandhost.com/image/58497759-original.html)

File Name : 088-089 rita
Runtime : 14min 30s
File Size : 110 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/W/3XrWg/088-089%20rita_thumb_0.jpg) (http://pimpandhost.com/image/58497760-original.html)

Download Links:

088-089 rita.rar (http://k2s.cc/file/c7786a6e531d8)
Title: 090 091 rita ira
Post by: squidmanheis on December 15, 2016, 11:55:15 pm
090-091 rita ira

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/W/3XrWt/090-091%20rita%20ira_cover.jpg) (http://pimpandhost.com/image/58497773-original.html)

File Name : 090-091 rita ira
Runtime : 11min 31s
File Size : 88.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/W/3XrWu/090-091%20rita%20ira_thumb_0.jpg) (http://pimpandhost.com/image/58497774-original.html)

Download Links:

090-091 rita ira.rar (http://k2s.cc/file/81010fa215910)
Title: 092 Anna Nabery
Post by: squidmanheis on December 16, 2016, 03:20:15 am
092 Anna Nabery

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/W/3XrWQ/092%20Anna%20Nabery_cover.jpg) (http://pimpandhost.com/image/58497796-original.html)

File Name : 092 Anna Nabery
Runtime : 9min 47s
File Size : 74.4 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/W/3XrWR/092%20Anna%20Nabery_thumb_0.jpg) (http://pimpandhost.com/image/58497797-original.html)

Download Links:

092 Anna Nabery.rar (http://k2s.cc/file/56030e575a398)
Title: 094 maya
Post by: squidmanheis on December 16, 2016, 06:45:17 am
094 maya

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/X/3XrX5/094%20maya_cover.jpg) (http://pimpandhost.com/image/58497811-original.html)

File Name : 094 maya
Runtime : 14min 45s
File Size : 112 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/r/X/3XrX7/094%20maya_thumb_0.jpg) (http://pimpandhost.com/image/58497813-original.html)

Download Links:

094 maya.rar (http://k2s.cc/file/14ac019e165c4)
Title: 104 alisa 01 CL
Post by: squidmanheis on December 16, 2016, 10:10:22 am
104 alisa 01 CL

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/g/40xgK/104%20alisa%2001_CL_cover.jpg) (http://pimpandhost.com/image/59233234-original.html)

File Name : 104 alisa 01_CL
Runtime : 2min 59s
File Size : 30.4 MB
File Type: wmv
Resolution : 640x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/g/40xgO/104%20alisa%2001_CL_thumb_0.jpg) (http://pimpandhost.com/image/59233238-original.html)

Download Links:

104 alisa 01_CL.rar (http://k2s.cc/file/765dfa3c2cbd1)
Title: 104 alisa 02 CL
Post by: squidmanheis on December 16, 2016, 01:35:13 pm
104 alisa 02 CL

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/g/40xgV/104%20alisa%2002_CL_cover.jpg) (http://pimpandhost.com/image/59233245-original.html)

File Name : 104 alisa 02_CL
Runtime : 3min 0s
File Size : 30.4 MB
File Type: wmv
Resolution : 640x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/g/40xgW/104%20alisa%2002_CL_thumb_0.jpg) (http://pimpandhost.com/image/59233246-original.html)

Download Links:

104 alisa 02_CL.rar (http://k2s.cc/file/98851ea8aa1cc)
Title: 104 alisa 03 CL
Post by: squidmanheis on December 16, 2016, 05:00:23 pm
104 alisa 03 CL

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/g/40xgY/104%20alisa%2003_CL_cover.jpg) (http://pimpandhost.com/image/59233248-original.html)

File Name : 104 alisa 03_CL
Runtime : 3min 0s
File Size : 30.0 MB
File Type: wmv
Resolution : 640x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xh0/104%20alisa%2003_CL_thumb_0.jpg) (http://pimpandhost.com/image/59233250-original.html)

Download Links:

104 alisa 03_CL.rar (http://k2s.cc/file/008492ff92d69)
Title: 104 alisa 04 CL
Post by: squidmanheis on December 16, 2016, 08:25:20 pm
104 alisa 04 CL

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xh4/104%20alisa%2004_CL_cover.jpg) (http://pimpandhost.com/image/59233254-original.html)

File Name : 104 alisa 04_CL
Runtime : 2min 41s
File Size : 27.0 MB
File Type: wmv
Resolution : 640x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xh5/104%20alisa%2004_CL_thumb_0.jpg) (http://pimpandhost.com/image/59233255-original.html)

Download Links:

104 alisa 04_CL.rar (http://k2s.cc/file/35487a16c9561)
Title: Alis 01 CL
Post by: squidmanheis on December 16, 2016, 11:50:22 pm
Alis 01 CL

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xh7/Alis%2001%20CL_cover.jpg) (http://pimpandhost.com/image/59233257-original.html)

File Name : Alis 01 CL
Runtime : 3min 0s
File Size : 31.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xh8/Alis%2001%20CL_thumb_0.jpg) (http://pimpandhost.com/image/59233258-original.html)

Download Links:

Alis 01 CL.rar (http://k2s.cc/file/082892f4bf499)
Title: Alis 02 CL
Post by: squidmanheis on December 17, 2016, 03:15:23 am
Alis 02 CL

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xhb/Alis%2002%20CL_cover.jpg) (http://pimpandhost.com/image/59233261-original.html)

File Name : Alis 02 CL
Runtime : 3min 0s
File Size : 31.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xhd/Alis%2002%20CL_thumb_0.jpg) (http://pimpandhost.com/image/59233263-original.html)

Download Links:

Alis 02 CL.rar (http://k2s.cc/file/5361868dba70d)
Title: Alis 03 CL
Post by: squidmanheis on December 17, 2016, 06:40:22 am
Alis 03 CL

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xho/Alis%2003%20CL_cover.jpg) (http://pimpandhost.com/image/59233274-original.html)

File Name : Alis 03 CL
Runtime : 3min 0s
File Size : 24.0 MB
File Type: wmv
Resolution : 640x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xhq/Alis%2003%20CL_thumb_0.jpg) (http://pimpandhost.com/image/59233276-original.html)

Download Links:

Alis 03 CL.rar (http://k2s.cc/file/66acd53682f33)
Title: Alis 04 CL
Post by: squidmanheis on December 17, 2016, 10:05:22 am
Alis 04 CL

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xhu/Alis%2004%20CL_cover.jpg) (http://pimpandhost.com/image/59233280-original.html)

File Name : Alis 04 CL
Runtime : 3min 0s
File Size : 24.0 MB
File Type: wmv
Resolution : 640x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xhx/Alis%2004%20CL_thumb_0.jpg) (http://pimpandhost.com/image/59233283-original.html)

Download Links:

Alis 04 CL.rar (http://k2s.cc/file/456bec55807f6)
Title: Alis 05 CL
Post by: squidmanheis on December 17, 2016, 01:30:43 pm
Alis 05 CL

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xhL/Alis%2005%20CL_cover.jpg) (http://pimpandhost.com/image/59233297-original.html)

File Name : Alis 05 CL
Runtime : 2min 59s
File Size : 24.0 MB
File Type: wmv
Resolution : 640x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xhP/Alis%2005%20CL_thumb_0.jpg) (http://pimpandhost.com/image/59233301-original.html)

Download Links:

Alis 05 CL.rar (http://k2s.cc/file/f3b91ab4e01a4)
Title: Alis 06 CL
Post by: squidmanheis on December 17, 2016, 04:55:24 pm
Alis 06 CL

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xhS/Alis%2006%20CL_cover.jpg) (http://pimpandhost.com/image/59233304-original.html)

File Name : Alis 06 CL
Runtime : 3min 7s
File Size : 25.0 MB
File Type: wmv
Resolution : 640x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xhT/Alis%2006%20CL_thumb_0.jpg) (http://pimpandhost.com/image/59233305-original.html)

Download Links:

Alis 06 CL.rar (http://k2s.cc/file/29f572d6ce180)
Title: apr07hr03
Post by: squidmanheis on December 17, 2016, 08:20:22 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/h/40xhZ/apr07hr03_cover.jpg) (http://pimpandhost.com/image/59233311-original.html)

File Name : apr07hr03
Runtime : 4min 50s
File Size : 99.6 MB
File Type: wmv
Resolution : 600x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/i/40xi2/apr07hr03_thumb_0.jpg) (http://pimpandhost.com/image/59233314-original.html)

Download Links:

apr07hr03.rar (http://k2s.cc/file/40422a3dd3916)
Title: aug07hr11
Post by: squidmanheis on December 17, 2016, 11:45:35 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/i/40xie/aug07hr11_cover.jpg) (http://pimpandhost.com/image/59233326-original.html)

File Name : aug07hr11
Runtime : 4min 23s
File Size : 91.8 MB
File Type: wmv
Resolution : 600x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/i/40xif/aug07hr11_thumb_0.jpg) (http://pimpandhost.com/image/59233327-original.html)

Download Links:

aug07hr11.rar (http://k2s.cc/file/ffb20f682961b)
Title: di castration is the cure
Post by: squidmanheis on December 18, 2016, 03:10:26 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/i/40xil/di-castration-is-the-cure_cover.jpg) (http://pimpandhost.com/image/59233333-original.html)

File Name : di-castration-is-the-cure
Runtime : 3min 29s
File Size : 76.4 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/i/40xim/di-castration-is-the-cure_thumb_0.jpg) (http://pimpandhost.com/image/59233334-original.html)

Download Links:

di-castration-is-the-cure.rar (http://k2s.cc/file/df0f457c84dcf)
Title: feb07hr01
Post by: squidmanheis on December 18, 2016, 06:35:23 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/i/40xiJ/feb07hr01_cover.jpg) (http://pimpandhost.com/image/59233357-original.html)

File Name : feb07hr01
Runtime : 2min 15s
File Size : 49.0 MB
File Type: wmv
Resolution : 600x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/i/40xiK/feb07hr01_thumb_0.jpg) (http://pimpandhost.com/image/59233358-original.html)

Download Links:

feb07hr01.rar (http://k2s.cc/file/b3f4392dcff71)
Title: Hot facesitting 0 Mistress Mariana
Post by: squidmanheis on December 18, 2016, 10:00:26 am
Hot facesitting 0 Mistress Mariana

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/n/3Xsn6/Hot%20facesitting%200%20Mistress%20Mariana%20_cover.jpg) (http://pimpandhost.com/image/58499424-original.html)

File Name : Hot facesitting 0 Mistress Mariana
Runtime : 15min 43s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/n/3Xsn7/Hot%20facesitting%200%20Mistress%20Mariana%20_thumb_0.jpg) (http://pimpandhost.com/image/58499425-original.html)

Download Links:

Hot facesitting 0 Mistress Mariana .rar (http://k2s.cc/file/0b04c0d2f3dba)
Title: Hot facesitting 1 Goddess Mary
Post by: squidmanheis on December 18, 2016, 01:25:20 pm
Hot facesitting 1 Goddess Mary

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/p/3Xspl/Hot%20facesitting%201%20Goddess%20Mary%20_cover.jpg) (http://pimpandhost.com/image/58499563-original.html)

File Name : Hot facesitting 1 Goddess Mary
Runtime : 9min 39s
File Size : 147 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/p/3Xspn/Hot%20facesitting%201%20Goddess%20Mary%20_thumb_0.jpg) (http://pimpandhost.com/image/58499565-original.html)

Download Links:

Hot facesitting 1 Goddess Mary .rar (http://k2s.cc/file/5e91d2d020f8b)
Title: Hot facesitting 1 Mistress Margarita
Post by: squidmanheis on December 18, 2016, 04:50:22 pm
Hot facesitting 1 Mistress Margarita

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/p/3XspJ/Hot%20facesitting%201%20Mistress%20Margarita%20_cover.jpg) (http://pimpandhost.com/image/58499587-original.html)

File Name : Hot facesitting 1 Mistress Margarita
Runtime : 16min 49s
File Size : 255 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/p/3XspK/Hot%20facesitting%201%20Mistress%20Margarita%20_thumb_0.jpg) (http://pimpandhost.com/image/58499588-original.html)

Download Links:

Hot facesitting 1 Mistress Margarita .rar (http://k2s.cc/file/fdd6a7addc790)
Title: Hot facesitting 1 Mistress Olga
Post by: squidmanheis on December 18, 2016, 08:15:20 pm
Hot facesitting 1 Mistress Olga

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/r/3Xsr6/Hot%20facesitting%201%20Mistress%20Olga%20_cover.jpg) (http://pimpandhost.com/image/58499672-original.html)

File Name : Hot facesitting 1 Mistress Olga
Runtime : 18min 31s
File Size : 173 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/r/3Xsr8/Hot%20facesitting%201%20Mistress%20Olga%20_thumb_0.jpg) (http://pimpandhost.com/image/58499674-original.html)

Download Links:

Hot facesitting 1 Mistress Olga .rar (http://k2s.cc/file/fb28ffe8a00ba)
Title: Hot facesitting 1 Young Brunette Part One
Post by: squidmanheis on December 18, 2016, 11:40:21 pm
Hot facesitting 1 Young Brunette Part One

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/r/3XsrY/Hot%20facesitting%201%20Young%20Brunette%20Part%20One_cover.jpg) (http://pimpandhost.com/image/58499726-original.html)

File Name : Hot facesitting 1 Young Brunette Part One
Runtime : 10min 53s
File Size : 160 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/r/3XsrZ/Hot%20facesitting%201%20Young%20Brunette%20Part%20One_thumb_0.jpg) (http://pimpandhost.com/image/58499727-original.html)

Download Links:

Hot facesitting 1 Young Brunette Part One.rar (http://k2s.cc/file/640b5cc0d1f49)
Title: Hot facesitting 2 Goddess July
Post by: squidmanheis on December 19, 2016, 03:05:23 am
Hot facesitting 2 Goddess July

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/s/3Xssp/Hot%20facesitting%202%20Goddess%20July%20_cover.jpg) (http://pimpandhost.com/image/58499753-original.html)

File Name : Hot facesitting 2 Goddess July
Runtime : 16min 24s
File Size : 260 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/s/3Xssq/Hot%20facesitting%202%20Goddess%20July%20_thumb_0.jpg) (http://pimpandhost.com/image/58499754-original.html)

Download Links:

Hot facesitting 2 Goddess July .rar (http://k2s.cc/file/ea0bed73742fa)
Title: Hot facesitting 2 Mistress Liza
Post by: squidmanheis on December 19, 2016, 06:31:21 am
Hot facesitting 2 Mistress Liza

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/s/3XssT/Hot%20facesitting%202%20Mistress%20Liza%20_cover.jpg) (http://pimpandhost.com/image/58499783-original.html)

File Name : Hot facesitting 2 Mistress Liza
Runtime : 17min 20s
File Size : 162 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/s/3XssU/Hot%20facesitting%202%20Mistress%20Liza%20_thumb_0.jpg) (http://pimpandhost.com/image/58499784-original.html)

Download Links:

Hot facesitting 2 Mistress Liza .rar (http://k2s.cc/file/4aaf8d5028ffb)
Title: Hot facesitting 2 Three Hottest Mistresses
Post by: squidmanheis on December 19, 2016, 09:56:23 am
Hot facesitting 2 Three Hottest Mistresses

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/t/3Xst4/Hot%20facesitting%202%20Three%20Hottest%20Mistresses_cover.jpg) (http://pimpandhost.com/image/58499794-original.html)

File Name : Hot facesitting 2 Three Hottest Mistresses
Runtime : 20min 55s
File Size : 331 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/t/3Xst6/Hot%20facesitting%202%20Three%20Hottest%20Mistresses_thumb_0.jpg) (http://pimpandhost.com/image/58499796-original.html)

Download Links:

Hot facesitting 2 Three Hottest Mistresses.rar (http://k2s.cc/file/b71c09e6c6e7c)
Title: Hot facesitting 2 Three Young School Bitches
Post by: squidmanheis on December 19, 2016, 01:21:21 pm
Hot facesitting 2 Three Young School-Bitches

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/t/3XstH/Hot%20facesitting%202%20Three%20Young%20School-Bitches%20_cover.jpg) (http://pimpandhost.com/image/58499833-original.html)

File Name : Hot facesitting 2 Three Young School-Bitches
Runtime : 13min 39s
File Size : 203 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/t/3XstI/Hot%20facesitting%202%20Three%20Young%20School-Bitches%20_thumb_0.jpg) (http://pimpandhost.com/image/58499834-original.html)

Download Links:

Hot facesitting 2 Three Young School-Bitches .rar (http://k2s.cc/file/2fb65158344df)
Title: Hot facesitting 2
Post by: squidmanheis on December 19, 2016, 04:46:20 pm
Hot facesitting 2

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/t/3XstZ/Hot%20facesitting%202_cover.jpg) (http://pimpandhost.com/image/58499851-original.html)

File Name : Hot facesitting 2
Runtime : 12min 36s
File Size : 299 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/u/3Xsu0/Hot%20facesitting%202_thumb_0.jpg) (http://pimpandhost.com/image/58499852-original.html)

Download Links:

Hot facesitting 2.rar (http://k2s.cc/file/e2fc4cbf2a4ad)
Title: Hot facesitting 3 FACESITTING
Post by: squidmanheis on December 19, 2016, 08:11:21 pm
Hot facesitting 3 FACESITTING

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/u/3Xsus/Hot%20facesitting%203%20FACESITTING%20_cover.jpg) (http://pimpandhost.com/image/58499880-original.html)

File Name : Hot facesitting 3 FACESITTING
Runtime : 14min 44s
File Size : 224 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/u/3Xsuv/Hot%20facesitting%203%20FACESITTING%20_thumb_0.jpg) (http://pimpandhost.com/image/58499883-original.html)

Download Links:

Hot facesitting 3 FACESITTING .rar (http://k2s.cc/file/eaa8fe6d02c67)
Title: Hot facesitting 3 Goddess Juliana
Post by: squidmanheis on December 19, 2016, 11:36:25 pm
Hot facesitting 3 Goddess Juliana

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3Xsv4/Hot%20facesitting%203%20Goddess%20Juliana%20_cover.jpg) (http://pimpandhost.com/image/58499918-original.html)

File Name : Hot facesitting 3 Goddess Juliana
Runtime : 11min 16s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3Xsv6/Hot%20facesitting%203%20Goddess%20Juliana%20_thumb_0.jpg) (http://pimpandhost.com/image/58499920-original.html)

Download Links:

Hot facesitting 3 Goddess Juliana .rar (http://k2s.cc/file/920760a08b9bd)
Title: Hot facesitting 3 Oksana Marika
Post by: squidmanheis on December 20, 2016, 03:01:17 am
Hot facesitting 3 Oksana   Marika

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3XsvA/Hot%20facesitting%203%20Oksana%20%20%20Marika%20_cover.jpg) (http://pimpandhost.com/image/58499950-original.html)

File Name : Hot facesitting 3 Oksana   Marika
Runtime : 14min 4s
File Size : 131 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3XsvB/Hot%20facesitting%203%20Oksana%20%20%20Marika%20_thumb_0.jpg) (http://pimpandhost.com/image/58499951-original.html)

Download Links:

Hot facesitting 3 Oksana   Marika .rar (http://k2s.cc/file/92775a6b0d733)
Title: Hot facesitting 3 Young Brunette Part Two
Post by: squidmanheis on December 20, 2016, 06:26:21 am
Hot facesitting 3 Young Brunette Part Two

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3XsvR/Hot%20facesitting%203%20Young%20Brunette%20Part%20Two%20_cover.jpg) (http://pimpandhost.com/image/58499967-original.html)

File Name : Hot facesitting 3 Young Brunette Part Two
Runtime : 14min 12s
File Size : 209 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/v/3XsvS/Hot%20facesitting%203%20Young%20Brunette%20Part%20Two%20_thumb_0.jpg) (http://pimpandhost.com/image/58499968-original.html)

Download Links:

Hot facesitting 3 Young Brunette Part Two .rar (http://k2s.cc/file/c8ab850b97940)
Title: Hot facesitting 3 Young Goddess Anna
Post by: squidmanheis on December 20, 2016, 09:51:20 am
Hot facesitting 3 Young Goddess Anna

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/w/3XswN/Hot%20facesitting%203%20Young%20Goddess%20Anna_cover.jpg) (http://pimpandhost.com/image/58500025-original.html)

File Name : Hot facesitting 3 Young Goddess Anna
Runtime : 13min 16s
File Size : 210 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/w/3XswP/Hot%20facesitting%203%20Young%20Goddess%20Anna_thumb_0.jpg) (http://pimpandhost.com/image/58500027-original.html)

Download Links:

Hot facesitting 3 Young Goddess Anna.rar (http://k2s.cc/file/250bea8d8a2de)
Title: Hot facesitting 3
Post by: squidmanheis on December 20, 2016, 01:16:24 pm
Hot facesitting 3

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/x/3Xsxv/Hot%20facesitting%203_cover.jpg) (http://pimpandhost.com/image/58500069-original.html)

File Name : Hot facesitting 3
Runtime : 10min 59s
File Size : 261 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/x/3Xsxw/Hot%20facesitting%203_thumb_0.jpg) (http://pimpandhost.com/image/58500070-original.html)

Download Links:

Hot facesitting 3.rar (http://k2s.cc/file/8b3ac0b3eb389)
Title: Hot facesitting 4 Goddesses Lera and Dasha
Post by: squidmanheis on December 20, 2016, 04:41:23 pm
Hot facesitting 4 Goddesses Lera and Dasha

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/x/3XsxO/Hot%20facesitting%204%20Goddesses%20Lera%20and%20Dasha_cover.jpg) (http://pimpandhost.com/image/58500088-original.html)

File Name : Hot facesitting 4 Goddesses Lera and Dasha
Runtime : 13min 8s
File Size : 195 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/x/3XsxP/Hot%20facesitting%204%20Goddesses%20Lera%20and%20Dasha_thumb_0.jpg) (http://pimpandhost.com/image/58500089-original.html)

Download Links:

Hot facesitting 4 Goddesses Lera and Dasha.rar (http://k2s.cc/file/7faac822880d6)
Title: Hot facesitting 4 Mistress Katya and Mistress Julia
Post by: squidmanheis on December 20, 2016, 08:06:25 pm
Hot facesitting 4 Mistress Katya and Mistress Julia

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/y/3Xsy0/Hot%20facesitting%204%20Mistress%20Katya%20and%20Mistress%20Julia%20_cover.jpg) (http://pimpandhost.com/image/58500100-original.html)

File Name : Hot facesitting 4 Mistress Katya and Mistress Julia
Runtime : 12min 9s
File Size : 181 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/y/3Xsy5/Hot%20facesitting%204%20Mistress%20Katya%20and%20Mistress%20Julia%20_thumb_0.jpg) (http://pimpandhost.com/image/58500105-original.html)

Download Links:

Hot facesitting 4 Mistress Katya and Mistress Julia .rar (http://k2s.cc/file/6ea588eaf9a1e)
Title: Hot facesitting 4 Mistresses Dasha
Post by: squidmanheis on December 20, 2016, 11:31:24 pm
Hot facesitting 4 Mistresses Dasha

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/y/3XsyW/Hot%20facesitting%204%20Mistresses%20Dasha%20_cover.jpg) (http://pimpandhost.com/image/58500158-original.html)

File Name : Hot facesitting 4 Mistresses Dasha
Runtime : 16min 35s
File Size : 252 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/y/3XsyX/Hot%20facesitting%204%20Mistresses%20Dasha%20_thumb_0.jpg) (http://pimpandhost.com/image/58500159-original.html)

Download Links:

Hot facesitting 4 Mistresses Dasha .rar (http://k2s.cc/file/1c4fc21379163)
Title: Hot facesitting 4 Three Sexy Mistresses Part One
Post by: squidmanheis on December 21, 2016, 02:56:24 am
Hot facesitting 4 Three Sexy Mistresses Part One

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/z/3Xszr/Hot%20facesitting%204%20Three%20Sexy%20Mistresses%20Part%20One%20_cover.jpg) (http://pimpandhost.com/image/58500189-original.html)

File Name : Hot facesitting 4 Three Sexy Mistresses Part One
Runtime : 14min 47s
File Size : 234 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/z/3Xszs/Hot%20facesitting%204%20Three%20Sexy%20Mistresses%20Part%20One%20_thumb_0.jpg) (http://pimpandhost.com/image/58500190-original.html)

Download Links:

Hot facesitting 4 Three Sexy Mistresses Part One .rar (http://k2s.cc/file/e4554cb9ff954)
Title: Hot facesitting 4
Post by: squidmanheis on December 21, 2016, 06:21:26 am
Hot facesitting 4

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/z/3XszJ/Hot%20facesitting%204_cover.jpg) (http://pimpandhost.com/image/58500207-original.html)

File Name : Hot facesitting 4
Runtime : 17min 47s
File Size : 262 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/z/3XszK/Hot%20facesitting%204_thumb_0.jpg) (http://pimpandhost.com/image/58500208-original.html)

Download Links:

Hot facesitting 4.rar (http://k2s.cc/file/3f199650c5566)
Title: Hot facesitting 5
Post by: squidmanheis on December 21, 2016, 09:46:24 am
Hot facesitting 5

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/D/3XsDk/Hot%20facesitting%205_cover.jpg) (http://pimpandhost.com/image/58500430-original.html)

File Name : Hot facesitting 5
Runtime : 14min 38s
File Size : 336 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/D/3XsDl/Hot%20facesitting%205_thumb_0.jpg) (http://pimpandhost.com/image/58500431-original.html)

Download Links:

Hot facesitting 5.rar (http://k2s.cc/file/b932fee1939d8)
Title: Hot facesitting 8 Goddess Natalya
Post by: squidmanheis on December 21, 2016, 01:11:23 pm
Hot facesitting 8 Goddess Natalya

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/K/3XsKP/Hot%20facesitting%208%20Goddess%20Natalya%20_cover.jpg) (http://pimpandhost.com/image/58500895-original.html)

File Name : Hot facesitting 8 Goddess Natalya
Runtime : 12min 39s
File Size : 192 MB
File Type: wmv
Resolution : 720x576

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/K/3XsKQ/Hot%20facesitting%208%20Goddess%20Natalya%20_thumb_0.jpg) (http://pimpandhost.com/image/58500896-original.html)

Download Links:

Hot facesitting 8 Goddess Natalya .rar (http://k2s.cc/file/69b8a53b7d741)
Title: I can breathe so who cares
Post by: squidmanheis on December 21, 2016, 04:36:25 pm
I can breathe so who cares

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/z/3Iqzs/I%20can%20breathe%20so%20who%20cares_cover.jpg) (http://pimpandhost.com/image/54917582-original.html)

File Name : I can breathe so who cares
Runtime : 14min 56s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/z/3Iqzu/I%20can%20breathe%20so%20who%20cares_thumb_m.jpg) (http://pimpandhost.com/image/54917584-original.html)

Download Links:

I can breathe so who cares.rar (http://k2s.cc/file/1d31e21063148)
Title: Lets spend the day together
Post by: squidmanheis on December 21, 2016, 08:01:23 pm
Lets spend the day together

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/U/3IqU4/Lets%20spend%20the%20day%20together_cover.jpg) (http://pimpandhost.com/image/54918860-original.html)

File Name : Lets spend the day together
Runtime : 15min 23s
File Size : 116 MB
File Type: wmv
Resolution : 640x360

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/q/U/3IqUg/Lets%20spend%20the%20day%20together_thumb_m.jpg) (http://pimpandhost.com/image/54918872-original.html)

Download Links:

Lets spend the day together.rar (http://k2s.cc/file/3abbcdf10bcb3)
Title: Making out with their assholes
Post by: squidmanheis on December 21, 2016, 11:26:22 pm
Making out with their assholes


File Name : Making out with their assholes
Runtime : 14min 20s
File Size : 140 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/1/3Ir1T/Making%20out%20with%20their%20assholes%20_thumb_m.jpg) (http://pimpandhost.com/image/54919345-original.html)

Download Links:

Making out with their assholes .rar (http://k2s.cc/file/6a22af1c062de)
Title: Megan in tight pants
Post by: squidmanheis on December 22, 2016, 02:54:17 am
Megan in tight pants

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/b/3Irbz/Megan%20in%20tight%20pants_cover.jpg) (http://pimpandhost.com/image/54919945-original.html)

File Name : Megan in tight pants
Runtime : 12min 1s
File Size : 117 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/b/3IrbA/Megan%20in%20tight%20pants_thumb_m.jpg) (http://pimpandhost.com/image/54919946-original.html)

Download Links:

Megan in tight pants.rar (http://k2s.cc/file/9d29128e58a24)
Title: Megan in tight pants
Post by: squidmanheis on December 22, 2016, 03:29:12 am
Megan in tight pants

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/b/3Irbz/Megan%20in%20tight%20pants_cover.jpg) (http://pimpandhost.com/image/54919945-original.html)

File Name : Megan in tight pants
Runtime : 12min 1s
File Size : 117 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/b/3IrbA/Megan%20in%20tight%20pants_thumb_m.jpg) (http://pimpandhost.com/image/54919946-original.html)

Download Links:

Megan in tight pants.rar (http://k2s.cc/file/9d29128e58a24)
Title: More of Felony facesitting and ass worship
Post by: squidmanheis on December 22, 2016, 06:16:24 am
More of Felony facesitting and ass worship


File Name : More of Felony facesitting and ass worship
Runtime : 15min 0s
File Size : 147 MB
File Type: wmv
Resolution : 640x480


Download Links:

More of Felony facesitting and ass worship.rar (http://k2s.cc/file/85da5bb58078a)
Title: Overbearing wife no more phone calls
Post by: squidmanheis on December 22, 2016, 09:41:24 am
Overbearing wife no more phone calls

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/v/3Irv1/Overbearing%20wife%20no%20more%20phone%20calls_cover.jpg) (http://pimpandhost.com/image/54921151-original.html)

File Name : Overbearing wife no more phone calls
Runtime : 13min 47s
File Size : 134 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/v/3Irv3/Overbearing%20wife%20no%20more%20phone%20calls_thumb_m.jpg) (http://pimpandhost.com/image/54921153-original.html)

Download Links:

Overbearing wife no more phone calls.rar (http://k2s.cc/file/33b1bf99f8004)
Title: Queened by The Queen
Post by: squidmanheis on December 22, 2016, 01:06:23 pm
Queened by The Queen

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/F/3IrFT/Queened%20by%20The%20Queen_cover.jpg) (http://pimpandhost.com/image/54921825-original.html)

File Name : Queened by The Queen
Runtime : 15min 0s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/F/3IrFU/Queened%20by%20The%20Queen_thumb_m.jpg) (http://pimpandhost.com/image/54921826-original.html)

Download Links:

Queened by The Queen.rar (http://k2s.cc/file/7f7d5fdb1d112)
Title: Resisting Is Useless
Post by: squidmanheis on December 22, 2016, 04:31:25 pm
Resisting Is Useless

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/P/3IrPk/Resisting%20Is%20Useless_cover.jpg) (http://pimpandhost.com/image/54922410-original.html)

File Name : Resisting Is Useless
Runtime : 14min 56s
File Size : 114 MB
File Type: wmv
Resolution : 640x360


Download Links:

Resisting Is Useless.rar (http://k2s.cc/file/dbfb36555d934)
Title: Sitting on her oral slave
Post by: squidmanheis on December 22, 2016, 07:56:24 pm
Sitting on her oral slave

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/T/3IrTv/Sitting%20on%20her%20oral%20slave_cover.jpg) (http://pimpandhost.com/image/54922669-original.html)

File Name : Sitting on her oral slave
Runtime : 15min 15s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/T/3IrTF/Sitting%20on%20her%20oral%20slave_thumb_m.jpg) (http://pimpandhost.com/image/54922679-original.html)

Download Links:

Sitting on her oral slave.rar (http://k2s.cc/file/f788058dab0e1)
Title: Smother 112a Andrea Devin
Post by: squidmanheis on December 22, 2016, 11:21:27 pm
Smother 112a - Andrea   Devin

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/Y/3XsYV/Smother%20112a%20-%20Andrea%20%20%20Devin_cover.jpg) (http://pimpandhost.com/image/58501769-original.html)

File Name : Smother 112a - Andrea   Devin
Runtime : 29min 22s
File Size : 229 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/Z/3XsZ2/Smother%20112a%20-%20Andrea%20%20%20Devin_thumb_0.jpg) (http://pimpandhost.com/image/58501776-original.html)

Download Links:

Smother 112a - Andrea   Devin.rar (http://k2s.cc/file/61d87d667399c)
Title: Smother 202
Post by: squidmanheis on December 23, 2016, 02:46:27 am
Smother 202

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/p/3XtpE/Smother%20202_cover.jpg) (http://pimpandhost.com/image/58503426-original.html)

File Name : Smother 202
Runtime : 5min 35s
File Size : 60.7 MB
File Type: wmv
Resolution : 320x240

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/t/p/3XtpO/Smother%20202_thumb_0.jpg) (http://pimpandhost.com/image/58503436-original.html)

Download Links:

Smother 202.rar (http://k2s.cc/file/2b43586a88462)
Title: Smother in my ass while I squirt on you
Post by: squidmanheis on December 23, 2016, 06:11:25 am
Smother in my ass while I squirt on you

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/W/3IrWv/Smother%20in%20my%20ass%20while%20I%20squirt%20on%20you_cover.jpg) (http://pimpandhost.com/image/54922855-original.html)

File Name : Smother in my ass while I squirt on you
Runtime : 15min 2s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/W/3IrWx/Smother%20in%20my%20ass%20while%20I%20squirt%20on%20you_thumb_m.jpg) (http://pimpandhost.com/image/54922857-original.html)

Download Links:

Smother in my ass while I squirt on you.rar (http://k2s.cc/file/72a2b72f9102a)
Title: Smothered DEEP in Venezuelen snatch
Post by: squidmanheis on December 23, 2016, 09:36:27 am
Smothered DEEP in Venezuelen snatch

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/Z/3IrZh/Smothered%20DEEP%20in%20Venezuelen%20snatch_cover.jpg) (http://pimpandhost.com/image/54923027-original.html)

File Name : Smothered DEEP in Venezuelen snatch
Runtime : 14min 54s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/r/Z/3IrZB/Smothered%20DEEP%20in%20Venezuelen%20snatch_thumb_m.jpg) (http://pimpandhost.com/image/54923047-original.html)

Download Links:

Smothered DEEP in Venezuelen snatch.rar (http://k2s.cc/file/e69f5442d0a5e)
Title: Spontaneous domination
Post by: squidmanheis on December 23, 2016, 01:01:28 pm
Spontaneous domination

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/1/3Is1S/Spontaneous%20domination_cover.jpg) (http://pimpandhost.com/image/54923188-original.html)

File Name : Spontaneous domination
Runtime : 14min 31s
File Size : 142 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/1/3Is1U/Spontaneous%20domination_thumb_m.jpg) (http://pimpandhost.com/image/54923190-original.html)

Download Links:

Spontaneous domination.rar (http://k2s.cc/file/fc7dc4afe07e4)
Title: St Patricks day smother
Post by: squidmanheis on December 23, 2016, 04:26:23 pm
St  Patricks day smother

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/3/3Is3t/St.%20Patricks%20day%20smother_cover.jpg) (http://pimpandhost.com/image/54923287-original.html)

File Name : St. Patricks day smother
Runtime : 15min 14s
File Size : 149 MB
File Type: wmv
Resolution : 640x480


Download Links:

St. Patricks day smother.rar (http://k2s.cc/file/09b62ff915784)
Title: Suffocation in Angels room
Post by: squidmanheis on December 23, 2016, 07:51:27 pm
Suffocation in Angels room

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/4/3Is4i/Suffocation%20in%20Angels%20room_cover.jpg) (http://pimpandhost.com/image/54923338-original.html)

File Name : Suffocation in Angels room
Runtime : 16min 6s
File Size : 122 MB
File Type: wmv
Resolution : 640x360

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/4/3Is4j/Suffocation%20in%20Angels%20room_thumb_m.jpg) (http://pimpandhost.com/image/54923339-original.html)

Download Links:

Suffocation in Angels room.rar (http://k2s.cc/file/396e7779fffbe)
Title: Sweaty Latina fucks his nose and tongue
Post by: squidmanheis on December 23, 2016, 11:16:30 pm
Sweaty Latina fucks his nose and tongue

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/5/3Is5I/Sweaty%20Latina%20fucks%20his%20nose%20and%20tongue_cover.jpg) (http://pimpandhost.com/image/54923426-original.html)

File Name : Sweaty Latina fucks his nose and tongue
Runtime : 15min 20s
File Size : 150 MB
File Type: wmv
Resolution : 640x480


Download Links:

Sweaty Latina fucks his nose and tongue.rar (http://k2s.cc/file/f086f4fc0e76c)
Title: The ass from heaven 2
Post by: squidmanheis on December 24, 2016, 02:41:28 am
The ass from heaven 2

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/8/3Is8i/The%20ass%20from%20heaven%202_cover.jpg) (http://pimpandhost.com/image/54923586-original.html)

File Name : The ass from heaven 2
Runtime : 12min 47s
File Size : 125 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/8/3Is8n/The%20ass%20from%20heaven%202_thumb_m.jpg) (http://pimpandhost.com/image/54923591-original.html)

Download Links:

The ass from heaven 2.rar (http://k2s.cc/file/354fc7e59e06a)
Title: The Russian missionary position
Post by: squidmanheis on December 24, 2016, 06:06:31 am
The Russian missionary position

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/g/3IsgM/The%20Russian%20missionary%20position_cover.jpg) (http://pimpandhost.com/image/54924112-original.html)

File Name : The Russian missionary position
Runtime : 15min 8s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/g/3IsgO/The%20Russian%20missionary%20position_thumb_m.jpg) (http://pimpandhost.com/image/54924114-original.html)

Download Links:

The Russian missionary position.rar (http://k2s.cc/file/41fa1849b3612)
Title: Thick blonde discovers facesitting and ass worship 1
Post by: squidmanheis on December 24, 2016, 09:31:32 am
Thick blonde discovers facesitting and ass worship 1

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/h/3Ishr/Thick%20blonde%20discovers%20facesitting%20and%20ass%20worship%201_cover.jpg) (http://pimpandhost.com/image/54924153-original.html)

File Name : Thick blonde discovers facesitting and ass worship 1
Runtime : 14min 50s
File Size : 145 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/h/3Isht/Thick%20blonde%20discovers%20facesitting%20and%20ass%20worship%201_thumb_m.jpg) (http://pimpandhost.com/image/54924155-original.html)

Download Links:

Thick blonde discovers facesitting and ass worship 1.rar (http://k2s.cc/file/f812ac4a1a83c)
Title: Thick blonde smother ass worship finale
Post by: squidmanheis on December 24, 2016, 12:56:47 pm
Thick blonde smother ass worship finale

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/i/3Isir/Thick%20blonde%20smother%20ass%20worship%20finale%20_cover.jpg) (http://pimpandhost.com/image/54924215-original.html)

File Name : Thick blonde smother ass worship finale
Runtime : 14min 59s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/i/3Isis/Thick%20blonde%20smother%20ass%20worship%20finale%20_thumb_m.jpg) (http://pimpandhost.com/image/54924216-original.html)

Download Links:

Thick blonde smother ass worship finale .rar (http://k2s.cc/file/c9040de6b28ee)
Title: Tied gagged blinded smothered and butt drops
Post by: squidmanheis on December 24, 2016, 04:21:47 pm
Tied gagged blinded smothered and butt drops

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/j/3IsjI/Tied%20gagged%20blinded%20smothered%20and%20butt%20drops%20_cover.jpg) (http://pimpandhost.com/image/54924294-original.html)

File Name : Tied gagged blinded smothered and butt drops
Runtime : 14min 42s
File Size : 144 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/j/3IsjJ/Tied%20gagged%20blinded%20smothered%20and%20butt%20drops%20_thumb_m.jpg) (http://pimpandhost.com/image/54924295-original.html)

Download Links:

Tied gagged blinded smothered and butt drops .rar (http://k2s.cc/file/4510bbef7be8f)
Title: Tiffany nude smothering
Post by: squidmanheis on December 24, 2016, 07:46:47 pm
Tiffany nude smothering

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/k/3IskO/Tiffany%20nude%20smothering_cover.jpg) (http://pimpandhost.com/image/54924362-original.html)

File Name : Tiffany nude smothering
Runtime : 15min 8s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/k/3IskP/Tiffany%20nude%20smothering_thumb_m.jpg) (http://pimpandhost.com/image/54924363-original.html)

Download Links:

Tiffany nude smothering.rar (http://k2s.cc/file/310e1b23a02e9)
Title: Tongue fucking Felonys ass
Post by: squidmanheis on December 24, 2016, 11:11:48 pm
Tongue fucking Felonys ass

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/m/3Ismm/Tongue%20fucking%20Felonys%20ass_cover.jpg) (http://pimpandhost.com/image/54924458-original.html)

File Name : Tongue fucking Felonys ass
Runtime : 13min 47s
File Size : 135 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/m/3Ismn/Tongue%20fucking%20Felonys%20ass_thumb_m.jpg) (http://pimpandhost.com/image/54924459-original.html)

Download Links:

Tongue fucking Felonys ass.rar (http://k2s.cc/file/401aee475197a)
Title: Under Alexiss black dress
Post by: squidmanheis on December 25, 2016, 02:36:52 am
Under Alexiss black dress

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/n/3Isno/Under%20Alexiss%20black%20dress_cover.jpg) (http://pimpandhost.com/image/54924522-original.html)

File Name : Under Alexiss black dress
Runtime : 15min 30s
File Size : 151 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/n/3Isnp/Under%20Alexiss%20black%20dress_thumb_m.jpg) (http://pimpandhost.com/image/54924523-original.html)

Download Links:

Under Alexiss black dress.rar (http://k2s.cc/file/9ec6faa29b86f)
Title: You hold him down and Ill sit on him
Post by: squidmanheis on December 25, 2016, 06:01:48 am
You hold him down and Ill sit on him

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/q/3Isqv/You%20hold%20him%20down%20and%20Ill%20sit%20on%20him_cover.jpg) (http://pimpandhost.com/image/54924715-original.html)

File Name : You hold him down and Ill sit on him
Runtime : 14min 57s
File Size : 146 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/q/3Isqw/You%20hold%20him%20down%20and%20Ill%20sit%20on%20him_thumb_m.jpg) (http://pimpandhost.com/image/54924716-original.html)

Download Links:

You hold him down and Ill sit on him.rar (http://k2s.cc/file/86fdf734389c9)
Title: Young girl with hairy pussy
Post by: squidmanheis on December 25, 2016, 09:26:47 am
Young girl with hairy pussy

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/s/3IssQ/Young%20girl%20with%20hairy%20pussy_cover.jpg) (http://pimpandhost.com/image/54924860-original.html)

File Name : Young girl with hairy pussy
Runtime : 12min 0s
File Size : 116 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/I/s/s/3IssR/Young%20girl%20with%20hairy%20pussy_thumb_m.jpg) (http://pimpandhost.com/image/54924861-original.html)

Download Links:

Young girl with hairy pussy.rar (http://k2s.cc/file/aca847d5a2bff)
Title: feb07hr03
Post by: squidmanheis on January 13, 2017, 04:45:12 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/i/40xiS/feb07hr03_cover.jpg) (http://pimpandhost.com/image/59233366-original.html)

File Name : feb07hr03
Runtime : 2min 27s
File Size : 53.4 MB
File Type: wmv
Resolution : 600x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/i/40xiU/feb07hr03_thumb_0.jpg) (http://pimpandhost.com/image/59233368-original.html)

Download Links:

feb07hr03.rar (http://k2s.cc/file/83a7a87e6c72a)
Title: Hot facesitting Mistress Julia Mistress Lera
Post by: squidmanheis on January 13, 2017, 08:10:04 am
Hot facesitting  Mistress Julia   Mistress Lera

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/d/3Xsdi/Hot%20facesitting%20%20Mistress%20Julia%20%20%20Mistress%20Lera%20_cover.jpg) (http://pimpandhost.com/image/58498816-original.html)

File Name : Hot facesitting  Mistress Julia   Mistress Lera
Runtime : 11min 33s
File Size : 111 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/d/3Xsdm/Hot%20facesitting%20%20Mistress%20Julia%20%20%20Mistress%20Lera%20_thumb_0.jpg) (http://pimpandhost.com/image/58498820-original.html)

Download Links:

Hot facesitting  Mistress Julia   Mistress Lera .rar (http://k2s.cc/file/ae7d36feb6760)
Title: Hot facesitting Mistress Julya Mistress Dasha
Post by: squidmanheis on January 13, 2017, 11:48:43 am
Hot facesitting  Mistress Julya   Mistress Dasha

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/f/3Xsfm/Hot%20facesitting%20%20Mistress%20Julya%20%20%20Mistress%20Dasha_cover.jpg) (http://pimpandhost.com/image/58498944-original.html)

File Name : Hot facesitting  Mistress Julya   Mistress Dasha
Runtime : 12min 26s
File Size : 119 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/f/3Xsfr/Hot%20facesitting%20%20Mistress%20Julya%20%20%20Mistress%20Dasha_thumb_0.jpg) (http://pimpandhost.com/image/58498949-original.html)

Download Links:

Hot facesitting  Mistress Julya   Mistress Dasha.rar (http://k2s.cc/file/ebe28ed2bbb22)
Title: Hot facesitting Mistress Julya
Post by: squidmanheis on January 13, 2017, 03:00:04 pm
Hot facesitting  Mistress Julya

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/h/3Xsh1/Hot%20facesitting%20%20Mistress%20Julya_cover.jpg) (http://pimpandhost.com/image/58499047-original.html)

File Name : Hot facesitting  Mistress Julya
Runtime : 13min 24s
File Size : 128 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/h/3Xsh5/Hot%20facesitting%20%20Mistress%20Julya_thumb_0.jpg) (http://pimpandhost.com/image/58499051-original.html)

Download Links:

Hot facesitting  Mistress Julya.rar (http://k2s.cc/file/b108a1a9fc942)
Title: Hot facesitting Mistress Masha Mistress Anna
Post by: squidmanheis on January 13, 2017, 06:25:02 pm
Hot facesitting  Mistress Masha   Mistress Anna

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/j/3Xsj7/Hot%20facesitting%20%20Mistress%20Masha%20%20%20Mistress%20Anna%20_cover.jpg) (http://pimpandhost.com/image/58499177-original.html)

File Name : Hot facesitting  Mistress Masha   Mistress Anna
Runtime : 13min 30s
File Size : 129 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/j/3Xsjc/Hot%20facesitting%20%20Mistress%20Masha%20%20%20Mistress%20Anna%20_thumb_0.jpg) (http://pimpandhost.com/image/58499182-original.html)

Download Links:

Hot facesitting  Mistress Masha   Mistress Anna .rar (http://k2s.cc/file/6dbfb4af36f50)
Title: Hot facesitting Mistress Masha
Post by: squidmanheis on January 13, 2017, 09:50:01 pm
Hot facesitting  Mistress Masha

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/j/3XsjK/Hot%20facesitting%20%20Mistress%20Masha%20_cover.jpg) (http://pimpandhost.com/image/58499216-original.html)

File Name : Hot facesitting  Mistress Masha
Runtime : 10min 0s
File Size : 95.9 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/j/3XsjP/Hot%20facesitting%20%20Mistress%20Masha%20_thumb_0.jpg) (http://pimpandhost.com/image/58499221-original.html)

Download Links:

Hot facesitting  Mistress Masha .rar (http://k2s.cc/file/8b34b3525e928)
Title: Hot facesitting Mistress Nastya
Post by: squidmanheis on January 14, 2017, 01:14:58 am
Hot facesitting  Mistress Nastya

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/k/3Xsk6/Hot%20facesitting%20%20Mistress%20Nastya%20_cover.jpg) (http://pimpandhost.com/image/58499238-original.html)

File Name : Hot facesitting  Mistress Nastya
Runtime : 11min 46s
File Size : 113 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/k/3Xsk7/Hot%20facesitting%20%20Mistress%20Nastya%20_thumb_0.jpg) (http://pimpandhost.com/image/58499239-original.html)

Download Links:

Hot facesitting  Mistress Nastya .rar (http://k2s.cc/file/b7666256f35ea)
Title: Hot facesitting Mistress Nastya
Post by: squidmanheis on January 14, 2017, 04:39:58 am
Hot facesitting  Mistress Nastya

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/k/3Xskk/Hot%20facesitting%20%20Mistress%20Nastya_cover.jpg) (http://pimpandhost.com/image/58499252-original.html)

File Name : Hot facesitting  Mistress Nastya
Runtime : 11min 28s
File Size : 110 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/k/3Xskp/Hot%20facesitting%20%20Mistress%20Nastya_thumb_0.jpg) (http://pimpandhost.com/image/58499257-original.html)

Download Links:

Hot facesitting  Mistress Nastya.rar (http://k2s.cc/file/6058c69d26ac9)
Title: Hot facesitting Mistress Tanya Mistress Lera
Post by: squidmanheis on January 14, 2017, 08:05:23 am
Hot facesitting  Mistress Tanya   Mistress Lera

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/k/3Xsku/Hot%20facesitting%20%20Mistress%20Tanya%20%20%20Mistress%20Lera_cover.jpg) (http://pimpandhost.com/image/58499262-original.html)

File Name : Hot facesitting  Mistress Tanya   Mistress Lera
Runtime : 10min 9s
File Size : 97.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/k/3Xskv/Hot%20facesitting%20%20Mistress%20Tanya%20%20%20Mistress%20Lera_thumb_0.jpg) (http://pimpandhost.com/image/58499263-original.html)

Download Links:

Hot facesitting  Mistress Tanya   Mistress Lera.rar (http://k2s.cc/file/102a53d43b057)
Title: Hot facesitting Mistress Violeta
Post by: squidmanheis on January 14, 2017, 11:30:32 am
Hot facesitting  Mistress Violeta

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/k/3XskR/Hot%20facesitting%20%20Mistress%20Violeta%20_cover.jpg) (http://pimpandhost.com/image/58499285-original.html)

File Name : Hot facesitting  Mistress Violeta
Runtime : 15min 16s
File Size : 143 MB
File Type: wmv
Resolution : 640x480

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/k/3XskX/Hot%20facesitting%20%20Mistress%20Violeta%20_thumb_0.jpg) (http://pimpandhost.com/image/58499291-original.html)

Download Links:

Hot facesitting  Mistress Violeta .rar (http://k2s.cc/file/6b58e35b7251c)
Title: Hot facesitting 0 FACESITTING
Post by: squidmanheis on January 14, 2017, 02:55:33 pm
Hot facesitting 0 FACESITTING

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/l/3XslE/Hot%20facesitting%200%20FACESITTING_cover.jpg) (http://pimpandhost.com/image/58499334-original.html)

File Name : Hot facesitting 0 FACESITTING
Runtime : 9min 54s
File Size : 150 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/l/3XslF/Hot%20facesitting%200%20FACESITTING_thumb_0.jpg) (http://pimpandhost.com/image/58499335-original.html)

Download Links:

Hot facesitting 0 FACESITTING.rar (http://k2s.cc/file/e8c995405f62b)
Title: Hot facesitting 0 Goddess Irena
Post by: squidmanheis on January 14, 2017, 06:20:31 pm
Hot facesitting 0 Goddess Irena

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/l/3XslX/Hot%20facesitting%200%20Goddess%20Irena%20_cover.jpg) (http://pimpandhost.com/image/58499353-original.html)

File Name : Hot facesitting 0 Goddess Irena
Runtime : 17min 33s
File Size : 258 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/l/3XslY/Hot%20facesitting%200%20Goddess%20Irena%20_thumb_0.jpg) (http://pimpandhost.com/image/58499354-original.html)

Download Links:

Hot facesitting 0 Goddess Irena .rar (http://k2s.cc/file/5195c3c703c72)
Title: Hot facesitting 0 Goddesses Natalya and Vika
Post by: squidmanheis on January 14, 2017, 09:45:29 pm
Hot facesitting 0 Goddesses Natalya and Vika

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/m/3XsmL/Hot%20facesitting%200%20Goddesses%20Natalya%20and%20Vika%20_cover.jpg) (http://pimpandhost.com/image/58499403-original.html)

File Name : Hot facesitting 0 Goddesses Natalya and Vika
Runtime : 12min 21s
File Size : 196 MB
File Type: wmv
Resolution : 720x576

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/m/3XsmN/Hot%20facesitting%200%20Goddesses%20Natalya%20and%20Vika%20_thumb_0.jpg) (http://pimpandhost.com/image/58499405-original.html)

Download Links:

Hot facesitting 0 Goddesses Natalya and Vika .rar (http://k2s.cc/file/0138c98801a89)
Title: Hot facesitting 0 Young Anna
Post by: squidmanheis on January 15, 2017, 01:10:28 am
Hot facesitting 0 Young Anna

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/n/3Xsnz/Hot%20facesitting%200%20Young%20Anna%20_cover.jpg) (http://pimpandhost.com/image/58499453-original.html)

File Name : Hot facesitting 0 Young Anna
Runtime : 14min 19s
File Size : 227 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/n/3XsnA/Hot%20facesitting%200%20Young%20Anna%20_thumb_0.jpg) (http://pimpandhost.com/image/58499454-original.html)

Download Links:

Hot facesitting 0 Young Anna .rar (http://k2s.cc/file/c2931019fa9e0)
Title: Hot facesitting 1 FACESITTING and PUSSY WORSHIP
Post by: squidmanheis on January 15, 2017, 04:35:27 am

(http://ist3-1.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/o/3XsoR/Hot%20facesitting%201%20FACESITTING%20and%20PUSSY%20WORSHIP%20_cover.jpg) (http://pimpandhost.com/image/58499533-original.html)

File Name : Hot facesitting 1 FACESITTING and PUSSY WORSHIP
Runtime : 12min 25s
File Size : 197 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-2.filesor.com/pimpandhost.com/1/2/4/5/124593/3/X/s/o/3XsoT/Hot%20facesitting%201%20FACESITTING%20and%20PUSSY%20WORSHIP%20_thumb_0.jpg) (http://pimpandhost.com/image/58499535-original.html)

Download Links:

Hot facesitting 1 FACESITTING and PUSSY WORSHIP .rar (http://k2s.cc/file/222705d8dd939)
Title: jan07hr07
Post by: squidmanheis on January 15, 2017, 08:00:25 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/i/40xiZ/jan07hr07_cover.jpg) (http://pimpandhost.com/image/59233373-original.html)

File Name : jan07hr07
Runtime : 5min 22s
File Size : 111 MB
File Type: wmv
Resolution : 600x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/j/40xj0/jan07hr07_thumb_0.jpg) (http://pimpandhost.com/image/59233374-original.html)

Download Links:

jan07hr07.rar (http://k2s.cc/file/0b6c9062b0fa3)
Title: jan07hr08
Post by: squidmanheis on January 15, 2017, 11:25:34 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/j/40xjl/jan07hr08_cover.jpg) (http://pimpandhost.com/image/59233395-original.html)

File Name : jan07hr08
Runtime : 4min 38s
File Size : 95.5 MB
File Type: wmv
Resolution : 600x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/j/40xjn/jan07hr08_thumb_0.jpg) (http://pimpandhost.com/image/59233397-original.html)

Download Links:

jan07hr08.rar (http://k2s.cc/file/2c6923f974333)
Title: jun07hr05
Post by: squidmanheis on January 15, 2017, 02:50:32 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/j/40xjE/jun07hr05_cover.jpg) (http://pimpandhost.com/image/59233414-original.html)

File Name : jun07hr05
Runtime : 3min 18s
File Size : 69.2 MB
File Type: wmv
Resolution : 600x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/j/40xjF/jun07hr05_thumb_0.jpg) (http://pimpandhost.com/image/59233415-original.html)

Download Links:

jun07hr05.rar (http://k2s.cc/file/36b474e857d69)
Title: lma a life of licking ass
Post by: squidmanheis on January 15, 2017, 06:15:31 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/j/40xjP/lma-a-life-of-licking-ass_cover.jpg) (http://pimpandhost.com/image/59233425-original.html)

File Name : lma-a-life-of-licking-ass
Runtime : 10min 19s
File Size : 227 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/j/40xjR/lma-a-life-of-licking-ass_thumb_0.jpg) (http://pimpandhost.com/image/59233427-original.html)

Download Links:

lma-a-life-of-licking-ass.rar (http://k2s.cc/file/74faafc3e21ad)
Title: lma a life of licking ass2
Post by: squidmanheis on January 15, 2017, 09:40:33 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/k/40xkx/lma-a-life-of-licking-ass2_cover.jpg) (http://pimpandhost.com/image/59233469-original.html)

File Name : lma-a-life-of-licking-ass2
Runtime : 11min 2s
File Size : 243 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/k/40xkz/lma-a-life-of-licking-ass2_thumb_0.jpg) (http://pimpandhost.com/image/59233471-original.html)

Download Links:

lma-a-life-of-licking-ass2.rar (http://k2s.cc/file/4335b8b7ef1e3)
Title: lma ariel loves butt drops
Post by: squidmanheis on January 16, 2017, 01:05:33 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/m/40xm0/lma-ariel-loves-butt-drops_cover.jpg) (http://pimpandhost.com/image/59233560-original.html)

File Name : lma-ariel-loves-butt-drops
Runtime : 5min 58s
File Size : 131 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/m/40xm3/lma-ariel-loves-butt-drops_thumb_0.jpg) (http://pimpandhost.com/image/59233563-original.html)

Download Links:

lma-ariel-loves-butt-drops.rar (http://k2s.cc/file/a4a5c082bcfda)
Title: lma ass addiction pov
Post by: squidmanheis on January 16, 2017, 04:30:41 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/n/40xn0/lma-ass-addiction-pov_cover.jpg) (http://pimpandhost.com/image/59233622-original.html)

File Name : lma-ass-addiction-pov
Runtime : 2min 31s
File Size : 55.1 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/n/40xn6/lma-ass-addiction-pov_thumb_0.jpg) (http://pimpandhost.com/image/59233628-original.html)

Download Links:

lma-ass-addiction-pov.rar (http://k2s.cc/file/f084f04699e68)
Title: lma a steady diet of my waste
Post by: squidmanheis on January 16, 2017, 07:55:29 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/l/40xlf/lma-a-steady-diet-of-my-waste_cover.jpg) (http://pimpandhost.com/image/59233513-original.html)

File Name : lma-a-steady-diet-of-my-waste
Runtime : 5min 31s
File Size : 121 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/l/40xli/lma-a-steady-diet-of-my-waste_thumb_0.jpg) (http://pimpandhost.com/image/59233516-original.html)

Download Links:

lma-a-steady-diet-of-my-waste.rar (http://k2s.cc/file/ef2db5399ed2f)
Title: lma auntpaigevisit ilovetofuckyourface
Post by: squidmanheis on January 16, 2017, 11:20:29 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/n/40xns/lma-auntpaigevisit-ilovetofuckyourface_cover.jpg) (http://pimpandhost.com/image/59233650-original.html)

File Name : lma-auntpaigevisit-ilovetofuckyourface
Runtime : 5min 15s
File Size : 115 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/n/40xnu/lma-auntpaigevisit-ilovetofuckyourface_thumb_0.jpg) (http://pimpandhost.com/image/59233652-original.html)

Download Links:

lma-auntpaigevisit-ilovetofuckyourface.rar (http://k2s.cc/file/5d75923b9f9d4)
Title: lma auntpaigevisit kennyearnshispussy
Post by: squidmanheis on January 16, 2017, 02:45:25 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/o/40xod/lma-auntpaigevisit-kennyearnshispussy_cover.jpg) (http://pimpandhost.com/image/59233697-original.html)

File Name : lma-auntpaigevisit-kennyearnshispussy
Runtime : 4min 51s
File Size : 107 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/o/40xof/lma-auntpaigevisit-kennyearnshispussy_thumb_0.jpg) (http://pimpandhost.com/image/59233699-original.html)

Download Links:

lma-auntpaigevisit-kennyearnshispussy.rar (http://k2s.cc/file/d488e245612c4)
Title: lma auntpaigevisit lickmyholekenny
Post by: squidmanheis on January 16, 2017, 06:10:28 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/o/40xoQ/lma-auntpaigevisit-lickmyholekenny_cover.jpg) (http://pimpandhost.com/image/59233736-original.html)

File Name : lma-auntpaigevisit-lickmyholekenny
Runtime : 6min 8s
File Size : 135 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/o/40xoT/lma-auntpaigevisit-lickmyholekenny_thumb_0.jpg) (http://pimpandhost.com/image/59233739-original.html)

Download Links:

lma-auntpaigevisit-lickmyholekenny.rar (http://k2s.cc/file/1af136a56e6e2)
Title: lma auntpaigevisit oralslaveryforkenny
Post by: squidmanheis on January 16, 2017, 09:35:26 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/p/40xpD/lma-auntpaigevisit-oralslaveryforkenny_cover.jpg) (http://pimpandhost.com/image/59233785-original.html)

File Name : lma-auntpaigevisit-oralslaveryforkenny
Runtime : 7min 8s
File Size : 157 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/p/40xpE/lma-auntpaigevisit-oralslaveryforkenny_thumb_0.jpg) (http://pimpandhost.com/image/59233786-original.html)

Download Links:

lma-auntpaigevisit-oralslaveryforkenny.rar (http://k2s.cc/file/c6a54790d39b1)
Title: lma auntpaigevisit spreadmycheeksandlick
Post by: squidmanheis on January 17, 2017, 01:00:28 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/r/40xrd/lma-auntpaigevisit-spreadmycheeksandlick_cover.jpg) (http://pimpandhost.com/image/59233883-original.html)

File Name : lma-auntpaigevisit-spreadmycheeksandlick
Runtime : 6min 9s
File Size : 135 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/r/40xrg/lma-auntpaigevisit-spreadmycheeksandlick_thumb_0.jpg) (http://pimpandhost.com/image/59233886-original.html)

Download Links:

lma-auntpaigevisit-spreadmycheeksandlick.rar (http://k2s.cc/file/d8e06e8ddce01)
Title: lma be careful what u wish for
Post by: squidmanheis on January 17, 2017, 04:25:33 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/t/40xtu/lma-be-careful-what-u-wish-for_cover.jpg) (http://pimpandhost.com/image/59234024-original.html)

File Name : lma-be-careful-what-u-wish-for
Runtime : 7min 9s
File Size : 157 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/t/40xtv/lma-be-careful-what-u-wish-for_thumb_0.jpg) (http://pimpandhost.com/image/59234025-original.html)

Download Links:

lma-be-careful-what-u-wish-for.rar (http://k2s.cc/file/bb7c07c8a3420)
Title: lma big butt smother
Post by: squidmanheis on January 17, 2017, 07:50:32 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/u/40xuf/lma-big-butt-smother_cover.jpg) (http://pimpandhost.com/image/59234071-original.html)

File Name : lma-big-butt-smother
Runtime : 6min 0s
File Size : 132 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/u/40xuj/lma-big-butt-smother_thumb_0.jpg) (http://pimpandhost.com/image/59234075-original.html)

Download Links:

lma-big-butt-smother.rar (http://k2s.cc/file/3de32be5fe77f)
Title: lma bound under my ass p03 f
Post by: squidmanheis on January 17, 2017, 11:15:46 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/v/40xv2/lma-bound-under-my-ass-p03-f_cover.jpg) (http://pimpandhost.com/image/59234120-original.html)

File Name : lma-bound-under-my-ass-p03-f
Runtime : 5min 29s
File Size : 120 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/v/40xv4/lma-bound-under-my-ass-p03-f_thumb_0.jpg) (http://pimpandhost.com/image/59234122-original.html)

Download Links:

lma-bound-under-my-ass-p03-f.rar (http://k2s.cc/file/fd5caaf1ec11d)
Title: lma clean it up cuckold
Post by: squidmanheis on January 17, 2017, 02:40:39 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/w/40xw5/lma-clean-it-up-cuckold_cover.jpg) (http://pimpandhost.com/image/59234185-original.html)

File Name : lma-clean-it-up-cuckold
Runtime : 9min 5s
File Size : 200 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/w/40xw8/lma-clean-it-up-cuckold_thumb_0.jpg) (http://pimpandhost.com/image/59234188-original.html)

Download Links:

lma-clean-it-up-cuckold.rar (http://k2s.cc/file/c82f1fc7f78f7)
Title: lma devotion to my caviar10
Post by: squidmanheis on January 17, 2017, 06:05:39 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/z/40xzp/lma-devotion-to-my-caviar10_cover.jpg) (http://pimpandhost.com/image/59234391-original.html)

File Name : lma-devotion-to-my-caviar10
Runtime : 10min 36s
File Size : 233 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/z/40xzt/lma-devotion-to-my-caviar10_thumb_0.jpg) (http://pimpandhost.com/image/59234395-original.html)

Download Links:

lma-devotion-to-my-caviar10.rar (http://k2s.cc/file/7f177dac0a75a)
Title: lma devotion to my caviar11
Post by: squidmanheis on January 17, 2017, 09:30:57 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/B/40xBw/lma-devotion-to-my-caviar11_cover.jpg) (http://pimpandhost.com/image/59234522-original.html)

File Name : lma-devotion-to-my-caviar11
Runtime : 13min 21s
File Size : 293 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/B/40xBA/lma-devotion-to-my-caviar11_thumb_0.jpg) (http://pimpandhost.com/image/59234526-original.html)

Download Links:

lma-devotion-to-my-caviar11.rar (http://k2s.cc/file/518e5d8959acf)
Title: lma devotion to my caviar8
Post by: squidmanheis on January 18, 2017, 12:55:43 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/E/40xEx/lma-devotion-to-my-caviar8_cover.jpg) (http://pimpandhost.com/image/59234709-original.html)

File Name : lma-devotion-to-my-caviar8
Runtime : 5min 52s
File Size : 129 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/E/40xEB/lma-devotion-to-my-caviar8_thumb_0.jpg) (http://pimpandhost.com/image/59234713-original.html)

Download Links:

lma-devotion-to-my-caviar8.rar (http://k2s.cc/file/93fa2eb8e8942)
Title: lma devotion to my caviar9
Post by: squidmanheis on January 18, 2017, 04:20:39 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/I/40xIk/lma-devotion-to-my-caviar9_cover.jpg) (http://pimpandhost.com/image/59234944-original.html)

File Name : lma-devotion-to-my-caviar9
Runtime : 4min 36s
File Size : 101 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/I/40xIu/lma-devotion-to-my-caviar9_thumb_0.jpg) (http://pimpandhost.com/image/59234954-original.html)

Download Links:

lma-devotion-to-my-caviar9.rar (http://k2s.cc/file/e617baf11a067)
Title: lma dirty babysitter
Post by: squidmanheis on January 18, 2017, 07:45:35 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/M/40xM0/lma-dirty-babysitter_cover.jpg) (http://pimpandhost.com/image/59235172-original.html)

File Name : lma-dirty-babysitter
Runtime : 13min 59s
File Size : 307 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/M/40xM4/lma-dirty-babysitter_thumb_0.jpg) (http://pimpandhost.com/image/59235176-original.html)

Download Links:

lma-dirty-babysitter.rar (http://k2s.cc/file/73a95e6e4865d)
Title: lma enjoy my sweaty ass bitch
Post by: squidmanheis on January 18, 2017, 11:10:38 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/O/40xOV/lma-enjoy-my-sweaty-ass-bitch_cover.jpg) (http://pimpandhost.com/image/59235353-original.html)

File Name : lma-enjoy-my-sweaty-ass-bitch
Runtime : 4min 38s
File Size : 102 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/O/40xOX/lma-enjoy-my-sweaty-ass-bitch_thumb_0.jpg) (http://pimpandhost.com/image/59235355-original.html)

Download Links:

lma-enjoy-my-sweaty-ass-bitch.rar (http://k2s.cc/file/2cd7b5ec726a1)
Title: lma expand those lungs
Post by: squidmanheis on January 18, 2017, 02:35:38 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/Q/40xQ3/lma-expand-those-lungs_cover.jpg) (http://pimpandhost.com/image/59235423-original.html)

File Name : lma-expand-those-lungs
Runtime : 6min 49s
File Size : 150 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/Q/40xQ6/lma-expand-those-lungs_thumb_0.jpg) (http://pimpandhost.com/image/59235426-original.html)

Download Links:

lma-expand-those-lungs.rar (http://k2s.cc/file/33c83c9f0454b)
Title: lma face punisher p01
Post by: squidmanheis on January 18, 2017, 06:01:04 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/R/40xRw/lma-face-punisher-p01_cover.jpg) (http://pimpandhost.com/image/59235514-original.html)

File Name : lma-face-punisher-p01
Runtime : 5min 48s
File Size : 128 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/R/40xRz/lma-face-punisher-p01_thumb_0.jpg) (http://pimpandhost.com/image/59235517-original.html)

Download Links:

lma-face-punisher-p01.rar (http://k2s.cc/file/c42864554d34e)
Title: lma face punisher p01
Post by: squidmanheis on January 18, 2017, 06:01:42 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/R/40xRw/lma-face-punisher-p01_cover.jpg) (http://pimpandhost.com/image/59235514-original.html)

File Name : lma-face-punisher-p01
Runtime : 5min 48s
File Size : 128 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/R/40xRz/lma-face-punisher-p01_thumb_0.jpg) (http://pimpandhost.com/image/59235517-original.html)

Download Links:

lma-face-punisher-p01.rar (http://k2s.cc/file/c42864554d34e)
Title: lma face punisher p02 f
Post by: squidmanheis on January 18, 2017, 09:25:39 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/T/40xTv/lma-face-punisher-p02-f_cover.jpg) (http://pimpandhost.com/image/59235637-original.html)

File Name : lma-face-punisher-p02-f
Runtime : 5min 11s
File Size : 114 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/T/40xTB/lma-face-punisher-p02-f_thumb_0.jpg) (http://pimpandhost.com/image/59235643-original.html)

Download Links:

lma-face-punisher-p02-f.rar (http://k2s.cc/file/a260d61a4b1c7)
Title: lma faceridingmybitch2
Post by: squidmanheis on January 19, 2017, 12:50:35 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/V/40xVd/lma-faceridingmybitch2_cover.jpg) (http://pimpandhost.com/image/59235743-original.html)

File Name : lma-faceridingmybitch2
Runtime : 6min 18s
File Size : 139 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/V/40xVn/lma-faceridingmybitch2_thumb_0.jpg) (http://pimpandhost.com/image/59235753-original.html)

Download Links:

lma-faceridingmybitch2.rar (http://k2s.cc/file/8e23693141531)
Title: lma fantasy dream cum true
Post by: squidmanheis on January 19, 2017, 04:15:38 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/X/40xXo/lma-fantasy-dream-cum-true_cover.jpg) (http://pimpandhost.com/image/59235878-original.html)

File Name : lma-fantasy-dream-cum-true
Runtime : 5min 41s
File Size : 125 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/x/X/40xXw/lma-fantasy-dream-cum-true_thumb_0.jpg) (http://pimpandhost.com/image/59235886-original.html)

Download Links:

lma-fantasy-dream-cum-true.rar (http://k2s.cc/file/3ff3613472e6c)
Title: lma fitness face crush
Post by: squidmanheis on January 19, 2017, 07:40:33 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/0/40y06/lma-fitness-face-crush_cover.jpg) (http://pimpandhost.com/image/59236046-original.html)

File Name : lma-fitness-face-crush
Runtime : 3min 12s
File Size : 70.3 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/0/40y0d/lma-fitness-face-crush_thumb_0.jpg) (http://pimpandhost.com/image/59236053-original.html)

Download Links:

lma-fitness-face-crush.rar (http://k2s.cc/file/b9fd7ddb266ef)
Title: lma fitness facesitter
Post by: squidmanheis on January 19, 2017, 11:05:30 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/1/40y1g/lma-fitness-facesitter_cover.jpg) (http://pimpandhost.com/image/59236118-original.html)

File Name : lma-fitness-facesitter
Runtime : 6min 12s
File Size : 136 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/1/40y1j/lma-fitness-facesitter_thumb_0.jpg) (http://pimpandhost.com/image/59236121-original.html)

Download Links:

lma-fitness-facesitter.rar (http://k2s.cc/file/e7ce11dc4b059)
Title: lma forced humantoiletpaper duties
Post by: squidmanheis on January 19, 2017, 02:30:30 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/3/40y35/lma-forced-humantoiletpaper-duties_cover.jpg) (http://pimpandhost.com/image/59236231-original.html)

File Name : lma-forced-humantoiletpaper-duties
Runtime : 11min 48s
File Size : 259 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/3/40y39/lma-forced-humantoiletpaper-duties_thumb_0.jpg) (http://pimpandhost.com/image/59236235-original.html)

Download Links:

lma-forced-humantoiletpaper-duties.rar (http://k2s.cc/file/b26dd7c7f407d)
Title: lma have a face full of my ass
Post by: squidmanheis on January 19, 2017, 05:55:29 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/6/40y6d/lma-have-a-face-full-of-my-ass_cover.jpg) (http://pimpandhost.com/image/59236425-original.html)

File Name : lma-have-a-face-full-of-my-ass
Runtime : 4min 33s
File Size : 100 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/6/40y6o/lma-have-a-face-full-of-my-ass_thumb_0.jpg) (http://pimpandhost.com/image/59236436-original.html)

Download Links:

lma-have-a-face-full-of-my-ass.rar (http://k2s.cc/file/1d65edd3d1e6f)
Title: lma his last football sunday
Post by: squidmanheis on January 19, 2017, 09:20:29 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/8/40y8b/lma-his-last-football-sunday_cover.jpg) (http://pimpandhost.com/image/59236547-original.html)

File Name : lma-his-last-football-sunday
Runtime : 15min 5s
File Size : 335 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/8/40y8i/lma-his-last-football-sunday_thumb_0.jpg) (http://pimpandhost.com/image/59236554-original.html)

Download Links:

lma-his-last-football-sunday.rar (http://k2s.cc/file/030ab24306c7d)
Title: lma human toilet paper bitch
Post by: squidmanheis on January 20, 2017, 12:45:28 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/c/40ycg/lma-human-toilet-paper-bitch_cover.jpg) (http://pimpandhost.com/image/59236800-original.html)

File Name : lma-human-toilet-paper-bitch
Runtime : 6min 15s
File Size : 137 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/c/40yck/lma-human-toilet-paper-bitch_thumb_0.jpg) (http://pimpandhost.com/image/59236804-original.html)

Download Links:

lma-human-toilet-paper-bitch.rar (http://k2s.cc/file/0cec8616115de)
Title: lma i am a bad bad girl
Post by: squidmanheis on January 20, 2017, 04:10:27 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/e/40yei/lma-i-am-a-bad-bad-girl_cover.jpg) (http://pimpandhost.com/image/59236926-original.html)

File Name : lma-i-am-a-bad-bad-girl
Runtime : 5min 55s
File Size : 130 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/e/40yet/lma-i-am-a-bad-bad-girl_thumb_0.jpg) (http://pimpandhost.com/image/59236937-original.html)

Download Links:

lma-i-am-a-bad-bad-girl.rar (http://k2s.cc/file/a559aff2842d2)
Title: lma i love getting my ass licked
Post by: squidmanheis on January 20, 2017, 07:35:27 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/i/40yi6/lma-i-love-getting-my-ass-licked_cover.jpg) (http://pimpandhost.com/image/59237162-original.html)

File Name : lma-i-love-getting-my-ass-licked
Runtime : 5min 12s
File Size : 114 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/i/40yid/lma-i-love-getting-my-ass-licked_thumb_0.jpg) (http://pimpandhost.com/image/59237169-original.html)

Download Links:

lma-i-love-getting-my-ass-licked.rar (http://k2s.cc/file/b0c988457cce2)
Title: lma i love grinding my jeans in your face
Post by: squidmanheis on January 20, 2017, 11:00:26 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/j/40yjQ/lma-i-love-grinding-my-jeans-in-your-face_cover.jpg) (http://pimpandhost.com/image/59237270-original.html)

File Name : lma-i-love-grinding-my-jeans-in-your-face
Runtime : 3min 46s
File Size : 82.8 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/j/40yjU/lma-i-love-grinding-my-jeans-in-your-face_thumb_0.jpg) (http://pimpandhost.com/image/59237274-original.html)

Download Links:

lma-i-love-grinding-my-jeans-in-your-face.rar (http://k2s.cc/file/7c833f754e630)
Title: lma i love to feel them struggle
Post by: squidmanheis on January 20, 2017, 02:25:25 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/l/40yl4/lma-i-love-to-feel-them-struggle_cover.jpg) (http://pimpandhost.com/image/59237346-original.html)

File Name : lma-i-love-to-feel-them-struggle
Runtime : 5min 44s
File Size : 126 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/l/40yl9/lma-i-love-to-feel-them-struggle_thumb_0.jpg) (http://pimpandhost.com/image/59237351-original.html)

Download Links:

lma-i-love-to-feel-them-struggle.rar (http://k2s.cc/file/488107be68e3e)
Title: lma interrogation under ass
Post by: squidmanheis on January 20, 2017, 05:50:12 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/p/40ypT/lma-interrogation-under-ass_cover.jpg) (http://pimpandhost.com/image/59237645-original.html)

File Name : lma-interrogation-under-ass
Runtime : 4min 49s
File Size : 106 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/q/40yq0/lma-interrogation-under-ass_thumb_0.jpg) (http://pimpandhost.com/image/59237652-original.html)

Download Links:

lma-interrogation-under-ass.rar (http://k2s.cc/file/ce89b8d75a754)
Title: lma i ride mens faces
Post by: squidmanheis on January 20, 2017, 09:15:24 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/n/40ynn/lma-i-ride-mens-faces_cover.jpg) (http://pimpandhost.com/image/59237489-original.html)

File Name : lma-i-ride-mens-faces
Runtime : 4min 23s
File Size : 96.5 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/n/40ynu/lma-i-ride-mens-faces_thumb_0.jpg) (http://pimpandhost.com/image/59237496-original.html)

Download Links:

lma-i-ride-mens-faces.rar (http://k2s.cc/file/99cafae5776c8)
Title: lma i want every morsel cleaned
Post by: squidmanheis on January 21, 2017, 12:40:24 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/o/40yow/lma-i-want-every-morsel-cleaned_cover.jpg) (http://pimpandhost.com/image/59237560-original.html)

File Name : lma-i-want-every-morsel-cleaned
Runtime : 5min 9s
File Size : 113 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/o/40yoy/lma-i-want-every-morsel-cleaned_thumb_0.jpg) (http://pimpandhost.com/image/59237562-original.html)

Download Links:

lma-i-want-every-morsel-cleaned.rar (http://k2s.cc/file/316662abf1a2a)
Title: lma kenny mummy bigadv p
Post by: squidmanheis on January 21, 2017, 04:05:27 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/t/40ytI/lma-kenny-mummy-bigadv-p_cover.jpg) (http://pimpandhost.com/image/59237882-original.html)

File Name : lma-kenny-mummy-bigadv-p
Runtime : 15min 18s
File Size : 336 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/t/40ytY/lma-kenny-mummy-bigadv-p_thumb_0.jpg) (http://pimpandhost.com/image/59237898-original.html)

Download Links:

lma-kenny-mummy-bigadv-p.rar (http://k2s.cc/file/e10f20aadbab0)
Title: lma kenny stepm0m fam adv p01
Post by: squidmanheis on January 21, 2017, 07:30:24 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/B/40yBp/lma-kenny-stepm0m-fam-adv-p01_cover.jpg) (http://pimpandhost.com/image/59238359-original.html)

File Name : lma-kenny-stepm0m-fam-adv-p01
Runtime : 5min 6s
File Size : 112 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/B/40yBv/lma-kenny-stepm0m-fam-adv-p01_thumb_0.jpg) (http://pimpandhost.com/image/59238365-original.html)

Download Links:

lma-kenny-stepm0m-fam-adv-p01.rar (http://k2s.cc/file/3866eb79bf66a)
Title: lma kenny stepm0m fam adv p04 f
Post by: squidmanheis on January 21, 2017, 10:55:21 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/C/40yCA/lma-kenny-stepm0m-fam-adv-p04-f_cover.jpg) (http://pimpandhost.com/image/59238432-original.html)

File Name : lma-kenny-stepm0m-fam-adv-p04-f
Runtime : 5min 25s
File Size : 119 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/C/40yCF/lma-kenny-stepm0m-fam-adv-p04-f_thumb_0.jpg) (http://pimpandhost.com/image/59238437-original.html)

Download Links:

lma-kenny-stepm0m-fam-adv-p04-f.rar (http://k2s.cc/file/77a9535c1ac18)
Title: lma kiss and lick the marks away
Post by: squidmanheis on January 21, 2017, 02:20:24 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/D/40yDM/lma-kiss-and-lick-the-marks-away_cover.jpg) (http://pimpandhost.com/image/59238506-original.html)

File Name : lma-kiss-and-lick-the-marks-away
Runtime : 3min 1s
File Size : 66.5 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/D/40yDQ/lma-kiss-and-lick-the-marks-away_thumb_0.jpg) (http://pimpandhost.com/image/59238510-original.html)

Download Links:

lma-kiss-and-lick-the-marks-away.rar (http://k2s.cc/file/72a93398340f2)
Title: lma lick my black ass
Post by: squidmanheis on January 21, 2017, 05:45:21 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/E/40yEl/lma-lick-my-black-ass_cover.jpg) (http://pimpandhost.com/image/59238541-original.html)

File Name : lma-lick-my-black-ass
Runtime : 4min 36s
File Size : 101 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/E/40yEn/lma-lick-my-black-ass_thumb_0.jpg) (http://pimpandhost.com/image/59238543-original.html)

Download Links:

lma-lick-my-black-ass.rar (http://k2s.cc/file/60c7ccf4b423b)
Title: lma lick only my asshole p01
Post by: squidmanheis on January 21, 2017, 09:10:23 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/F/40yF5/lma-lick-only-my-asshole-p01_cover.jpg) (http://pimpandhost.com/image/59238587-original.html)

File Name : lma-lick-only-my-asshole-p01
Runtime : 5min 49s
File Size : 128 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/F/40yF8/lma-lick-only-my-asshole-p01_thumb_0.jpg) (http://pimpandhost.com/image/59238590-original.html)

Download Links:

lma-lick-only-my-asshole-p01.rar (http://k2s.cc/file/deac009dd68d3)
Title: lma lick only my asshole p02 f
Post by: squidmanheis on January 22, 2017, 12:35:19 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/G/40yG5/lma-lick-only-my-asshole-p02-f_cover.jpg) (http://pimpandhost.com/image/59238649-original.html)

File Name : lma-lick-only-my-asshole-p02-f
Runtime : 5min 41s
File Size : 125 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/G/40yG8/lma-lick-only-my-asshole-p02-f_thumb_0.jpg) (http://pimpandhost.com/image/59238652-original.html)

Download Links:

lma-lick-only-my-asshole-p02-f.rar (http://k2s.cc/file/33dd6714aa937)
Title: lma melody loves to smother
Post by: squidmanheis on January 22, 2017, 04:00:19 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/H/40yHj/lma-melody-loves-to-smother_cover.jpg) (http://pimpandhost.com/image/59238725-original.html)

File Name : lma-melody-loves-to-smother
Runtime : 6min 1s
File Size : 132 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/H/40yHq/lma-melody-loves-to-smother_thumb_0.jpg) (http://pimpandhost.com/image/59238732-original.html)

Download Links:

lma-melody-loves-to-smother.rar (http://k2s.cc/file/a1e696a4cfef7)
Title: lma my hot young ass needs an ass bitch
Post by: squidmanheis on January 22, 2017, 07:25:19 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/I/40yIU/lma-my-hot-young-ass-needs-an-ass-bitch_cover.jpg) (http://pimpandhost.com/image/59238824-original.html)

File Name : lma-my-hot-young-ass-needs-an-ass-bitch
Runtime : 3min 55s
File Size : 86.0 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/I/40yIZ/lma-my-hot-young-ass-needs-an-ass-bitch_thumb_0.jpg) (http://pimpandhost.com/image/59238829-original.html)

Download Links:

lma-my-hot-young-ass-needs-an-ass-bitch.rar (http://k2s.cc/file/e9ed7a8c52bc5)
Title: lma my jeans can punish
Post by: squidmanheis on January 22, 2017, 10:50:17 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/J/40yJr/lma-my-jeans-can-punish_cover.jpg) (http://pimpandhost.com/image/59238857-original.html)

File Name : lma-my-jeans-can-punish
Runtime : 4min 28s
File Size : 98.2 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/J/40yJs/lma-my-jeans-can-punish_thumb_0.jpg) (http://pimpandhost.com/image/59238858-original.html)

Download Links:

lma-my-jeans-can-punish.rar (http://k2s.cc/file/26b7ba95f9722)
Title: lma party toilet p07
Post by: squidmanheis on January 22, 2017, 02:15:18 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/L/40yL5/lma-party-toilet-p07_cover.jpg) (http://pimpandhost.com/image/59238959-original.html)

File Name : lma-party-toilet-p07
Runtime : 3min 12s
File Size : 70.3 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/L/40yL6/lma-party-toilet-p07_thumb_0.jpg) (http://pimpandhost.com/image/59238960-original.html)

Download Links:

lma-party-toilet-p07.rar (http://k2s.cc/file/d523f080c99e1)
Title: lma party toilet p08
Post by: squidmanheis on January 22, 2017, 05:44:58 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/L/40yLz/lma-party-toilet-p08_cover.jpg) (http://pimpandhost.com/image/59238989-original.html)

File Name : lma-party-toilet-p08
Runtime : 4min 46s
File Size : 105 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/L/40yLD/lma-party-toilet-p08_thumb_0.jpg) (http://pimpandhost.com/image/59238993-original.html)

Download Links:

lma-party-toilet-p08.rar (http://k2s.cc/file/baf7ffc862083)
Title: lma pink panty facesitter
Post by: squidmanheis on January 22, 2017, 09:05:17 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/M/40yMG/lma-pink-panty-facesitter_cover.jpg) (http://pimpandhost.com/image/59239058-original.html)

File Name : lma-pink-panty-facesitter
Runtime : 8min 0s
File Size : 176 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/M/40yMK/lma-pink-panty-facesitter_thumb_0.jpg) (http://pimpandhost.com/image/59239062-original.html)

Download Links:

lma-pink-panty-facesitter.rar (http://k2s.cc/file/f239c6c21b23b)
Title: lma pleasure me bitch p01
Post by: squidmanheis on January 23, 2017, 12:30:16 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/N/40yNz/lma-pleasure-me-bitch-p01_cover.jpg) (http://pimpandhost.com/image/59239113-original.html)

File Name : lma-pleasure-me-bitch-p01
Runtime : 5min 33s
File Size : 122 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/N/40yNB/lma-pleasure-me-bitch-p01_thumb_0.jpg) (http://pimpandhost.com/image/59239115-original.html)

Download Links:

lma-pleasure-me-bitch-p01.rar (http://k2s.cc/file/9697a30752392)
Title: lma pleasure me bitch p02 f
Post by: squidmanheis on January 23, 2017, 03:55:13 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/P/40yPX/lma-pleasure-me-bitch-p02-f_cover.jpg) (http://pimpandhost.com/image/59239261-original.html)

File Name : lma-pleasure-me-bitch-p02-f
Runtime : 5min 15s
File Size : 115 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/Q/40yQd/lma-pleasure-me-bitch-p02-f_thumb_0.jpg) (http://pimpandhost.com/image/59239277-original.html)

Download Links:

lma-pleasure-me-bitch-p02-f.rar (http://k2s.cc/file/b560d59b54dd0)
Title: lma punched and smothered
Post by: squidmanheis on January 23, 2017, 07:20:12 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/U/40yU6/lma-punched-and-smothered_cover.jpg) (http://pimpandhost.com/image/59239518-original.html)

File Name : lma-punched-and-smothered
Runtime : 5min 8s
File Size : 109 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/U/40yUa/lma-punched-and-smothered_thumb_0.jpg) (http://pimpandhost.com/image/59239522-original.html)

Download Links:

lma-punched-and-smothered.rar (http://k2s.cc/file/740c58a832a93)
Title: lma purpose of mouth and tongue
Post by: squidmanheis on January 23, 2017, 10:45:14 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/V/40yVt/lma-purpose-of-mouth-and-tongue_cover.jpg) (http://pimpandhost.com/image/59239603-original.html)

File Name : lma-purpose-of-mouth-and-tongue
Runtime : 6min 37s
File Size : 145 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/V/40yVw/lma-purpose-of-mouth-and-tongue_thumb_0.jpg) (http://pimpandhost.com/image/59239606-original.html)

Download Links:

lma-purpose-of-mouth-and-tongue.rar (http://k2s.cc/file/22f1674b1eadd)
Title: lma ram it
Post by: squidmanheis on January 23, 2017, 02:10:13 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/X/40yX3/lma-ram-it_cover.jpg) (http://pimpandhost.com/image/59239701-original.html)

File Name : lma-ram-it
Runtime : 5min 35s
File Size : 123 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/y/X/40yXa/lma-ram-it_thumb_0.jpg) (http://pimpandhost.com/image/59239708-original.html)

Download Links:

lma-ram-it.rar (http://k2s.cc/file/ee5ac0675320a)
Title: lma red heeled facesitter
Post by: squidmanheis on January 23, 2017, 05:36:13 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/4/40z4T/lma-red-heeled-facesitter_cover.jpg) (http://pimpandhost.com/image/59240187-original.html)

File Name : lma-red-heeled-facesitter
Runtime : 6min 48s
File Size : 149 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/4/40z4X/lma-red-heeled-facesitter_thumb_0.jpg) (http://pimpandhost.com/image/59240191-original.html)

Download Links:

lma-red-heeled-facesitter.rar (http://k2s.cc/file/6c3493e609883)
Title: lma school detention asslicker
Post by: squidmanheis on January 23, 2017, 09:01:10 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/5/40z5R/lma-school-detention-asslicker_cover.jpg) (http://pimpandhost.com/image/59240247-original.html)

File Name : lma-school-detention-asslicker
Runtime : 8min 48s
File Size : 193 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/5/40z5U/lma-school-detention-asslicker_thumb_0.jpg) (http://pimpandhost.com/image/59240250-original.html)

Download Links:

lma-school-detention-asslicker.rar (http://k2s.cc/file/ac3c63e33f320)
Title: lma severe full toilet humiliation
Post by: squidmanheis on January 24, 2017, 12:26:10 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/7/40z76/lma-severe-full-toilet-humiliation_cover.jpg) (http://pimpandhost.com/image/59240324-original.html)

File Name : lma-severe-full-toilet-humiliation
Runtime : 10min 52s
File Size : 239 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/7/40z79/lma-severe-full-toilet-humiliation_thumb_0.jpg) (http://pimpandhost.com/image/59240327-original.html)

Download Links:

lma-severe-full-toilet-humiliation.rar (http://k2s.cc/file/ee0b8261be3f6)
Title: lma sisterknowsbest brolicksbetterthanagirl
Post by: squidmanheis on January 24, 2017, 03:51:09 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/a/40zaa/lma-sisterknowsbest-brolicksbetterthanagirl_cover.jpg) (http://pimpandhost.com/image/59240514-original.html)

File Name : lma-sisterknowsbest-brolicksbetterthanagirl
Runtime : 3min 56s
File Size : 86.5 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/a/40zac/lma-sisterknowsbest-brolicksbetterthanagirl_thumb_0.jpg) (http://pimpandhost.com/image/59240516-original.html)

Download Links:

lma-sisterknowsbest-brolicksbetterthanagirl.rar (http://k2s.cc/file/553c5ffbdf21f)
Title: lma sisterknowsbest brolicksbetterthanagirl p02
Post by: squidmanheis on January 24, 2017, 07:16:09 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/9/40z9m/lma-sisterknowsbest-brolicksbetterthanagirl-p02_cover.jpg) (http://pimpandhost.com/image/59240464-original.html)

File Name : lma-sisterknowsbest-brolicksbetterthanagirl-p02
Runtime : 3min 20s
File Size : 73.1 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/9/40z9n/lma-sisterknowsbest-brolicksbetterthanagirl-p02_thumb_0.jpg) (http://pimpandhost.com/image/59240465-original.html)

Download Links:

lma-sisterknowsbest-brolicksbetterthanagirl-p02.rar (http://k2s.cc/file/70dfc8ffd875d)
Title: lma sisterknowsbest brolicksbetterthanagirl p03
Post by: squidmanheis on January 24, 2017, 10:41:09 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/9/40z9O/lma-sisterknowsbest-brolicksbetterthanagirl-p03_cover.jpg) (http://pimpandhost.com/image/59240492-original.html)

File Name : lma-sisterknowsbest-brolicksbetterthanagirl-p03
Runtime : 3min 34s
File Size : 78.3 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/9/40z9P/lma-sisterknowsbest-brolicksbetterthanagirl-p03_thumb_0.jpg) (http://pimpandhost.com/image/59240493-original.html)

Download Links:

lma-sisterknowsbest-brolicksbetterthanagirl-p03.rar (http://k2s.cc/file/2339926ecda09)
Title: lma sisterknowsbest bro munch my anus
Post by: squidmanheis on January 24, 2017, 02:06:07 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/9/40z98/lma-sisterknowsbest-bro-munch-my-anus_cover.jpg) (http://pimpandhost.com/image/59240450-original.html)

File Name : lma-sisterknowsbest-bro-munch-my-anus
Runtime : 6min 18s
File Size : 138 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/9/40z9a/lma-sisterknowsbest-bro-munch-my-anus_thumb_0.jpg) (http://pimpandhost.com/image/59240452-original.html)

Download Links:

lma-sisterknowsbest-bro-munch-my-anus.rar (http://k2s.cc/file/82c465bd43636)
Title: lma sniff and lick my sweaty ass
Post by: squidmanheis on January 24, 2017, 05:31:10 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/a/40zal/lma-sniff-and-lick-my-sweaty-ass_cover.jpg) (http://pimpandhost.com/image/59240525-original.html)

File Name : lma-sniff-and-lick-my-sweaty-ass
Runtime : 3min 22s
File Size : 73.9 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/a/40zam/lma-sniff-and-lick-my-sweaty-ass_thumb_0.jpg) (http://pimpandhost.com/image/59240526-original.html)

Download Links:

lma-sniff-and-lick-my-sweaty-ass.rar (http://k2s.cc/file/175509c632f90)
Title: lma sometimes i prefer girls
Post by: squidmanheis on January 24, 2017, 08:56:06 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/a/40zas/lma-sometimes-i-prefer-girls_cover.jpg) (http://pimpandhost.com/image/59240532-original.html)

File Name : lma-sometimes-i-prefer-girls
Runtime : 4min 6s
File Size : 90.1 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/a/40zav/lma-sometimes-i-prefer-girls_thumb_0.jpg) (http://pimpandhost.com/image/59240535-original.html)

Download Links:

lma-sometimes-i-prefer-girls.rar (http://k2s.cc/file/460005fc7557d)
Title: lma step daddy gets to lick my ass
Post by: squidmanheis on January 25, 2017, 12:21:05 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/b/40zb7/lma-step-daddy-gets-to-lick-my-ass_cover.jpg) (http://pimpandhost.com/image/59240573-original.html)

File Name : lma-step-daddy-gets-to-lick-my-ass
Runtime : 5min 39s
File Size : 124 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/b/40zb8/lma-step-daddy-gets-to-lick-my-ass_thumb_0.jpg) (http://pimpandhost.com/image/59240574-original.html)

Download Links:

lma-step-daddy-gets-to-lick-my-ass.rar (http://k2s.cc/file/dc45079ef5f96)
Title: lma stoolboundassicker5
Post by: squidmanheis on January 25, 2017, 03:46:06 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/b/40zbQ/lma-stoolboundassicker5_cover.jpg) (http://pimpandhost.com/image/59240618-original.html)

File Name : lma-stoolboundassicker5
Runtime : 6min 17s
File Size : 138 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/b/40zbT/lma-stoolboundassicker5_thumb_0.jpg) (http://pimpandhost.com/image/59240621-original.html)

Download Links:

lma-stoolboundassicker5.rar (http://k2s.cc/file/0e3e7d11f6b54)
Title: lma suck mothers ass
Post by: squidmanheis on January 25, 2017, 07:11:05 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/d/40zd3/lma-suck-mothers-ass_cover.jpg) (http://pimpandhost.com/image/59240693-original.html)

File Name : lma-suck-mothers-ass
Runtime : 5min 18s
File Size : 117 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/d/40zd9/lma-suck-mothers-ass_thumb_0.jpg) (http://pimpandhost.com/image/59240699-original.html)

Download Links:

lma-suck-mothers-ass.rar (http://k2s.cc/file/a7a3dbed06488)
Title: lma suffer under my ass p02 f
Post by: squidmanheis on January 25, 2017, 10:36:06 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/e/40ze1/lma-suffer-under-my-ass-p02-f_cover.jpg) (http://pimpandhost.com/image/59240753-original.html)

File Name : lma-suffer-under-my-ass-p02-f
Runtime : 4min 54s
File Size : 108 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/e/40ze2/lma-suffer-under-my-ass-p02-f_thumb_0.jpg) (http://pimpandhost.com/image/59240754-original.html)

Download Links:

lma-suffer-under-my-ass-p02-f.rar (http://k2s.cc/file/5a6202a55d9e1)
Title: lma swallow my cum farts2
Post by: squidmanheis on January 25, 2017, 02:01:03 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/e/40zed/lma-swallow-my-cum-farts2_cover.jpg) (http://pimpandhost.com/image/59240765-original.html)

File Name : lma-swallow-my-cum-farts2
Runtime : 4min 21s
File Size : 95.5 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/e/40zee/lma-swallow-my-cum-farts2_thumb_0.jpg) (http://pimpandhost.com/image/59240766-original.html)

Download Links:

lma-swallow-my-cum-farts2.rar (http://k2s.cc/file/25f5517062df5)
Title: lma the power of jeans
Post by: squidmanheis on January 25, 2017, 05:26:05 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/e/40zeu/lma-the-power-of-jeans_cover.jpg) (http://pimpandhost.com/image/59240782-original.html)

File Name : lma-the-power-of-jeans
Runtime : 6min 54s
File Size : 152 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/e/40zev/lma-the-power-of-jeans_thumb_0.jpg) (http://pimpandhost.com/image/59240783-original.html)

Download Links:

lma-the-power-of-jeans.rar (http://k2s.cc/file/0878095f60232)
Title: lma toilet paper tongue
Post by: squidmanheis on January 25, 2017, 08:51:01 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/e/40zeT/lma-toilet-paper-tongue_cover.jpg) (http://pimpandhost.com/image/59240807-original.html)

File Name : lma-toilet-paper-tongue
Runtime : 16min 39s
File Size : 366 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/e/40zeV/lma-toilet-paper-tongue_thumb_0.jpg) (http://pimpandhost.com/image/59240809-original.html)

Download Links:

lma-toilet-paper-tongue.rar (http://k2s.cc/file/f5f070cfee6df)
Title: lma under ass ass ass p01
Post by: squidmanheis on January 26, 2017, 12:17:14 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/f/40zfW/lma-under-ass-ass-ass-p01_cover.jpg) (http://pimpandhost.com/image/59240872-original.html)

File Name : lma-under-ass-ass-ass-p01
Runtime : 5min 31s
File Size : 121 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/f/40zfX/lma-under-ass-ass-ass-p01_thumb_0.jpg) (http://pimpandhost.com/image/59240873-original.html)

Download Links:

lma-under-ass-ass-ass-p01.rar (http://k2s.cc/file/6990134bcf1aa)
Title: lma we love ass worship p[1]
Post by: squidmanheis on January 26, 2017, 03:41:25 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/g/40zge/lma-we-love-ass-worship-p_1__cover.jpg) (http://pimpandhost.com/image/59240890-original.html)

File Name : lma-we-love-ass-worship-p[1]
Runtime : 10min 15s
File Size : 225 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/g/40zgf/lma-we-love-ass-worship-p_1__thumb_0.jpg) (http://pimpandhost.com/image/59240891-original.html)

Download Links:

lma-we-love-ass-worship-p[1].rar (http://k2s.cc/file/c357bd7faf81d)
Title: lma with and without p
Post by: squidmanheis on January 26, 2017, 07:06:23 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/g/40zgW/lma-with-and-without-p_cover.jpg) (http://pimpandhost.com/image/59240934-original.html)

File Name : lma-with-and-without-p
Runtime : 10min 16s
File Size : 228 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/h/40zh1/lma-with-and-without-p_thumb_0.jpg) (http://pimpandhost.com/image/59240939-original.html)

Download Links:

lma-with-and-without-p.rar (http://k2s.cc/file/74b5c852f0ee6)
Title: lma your face is for my abuse
Post by: squidmanheis on January 26, 2017, 10:31:20 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/j/40zj1/lma-your-face-is-for-my-abuse_cover.jpg) (http://pimpandhost.com/image/59241063-original.html)

File Name : lma-your-face-is-for-my-abuse
Runtime : 5min 34s
File Size : 122 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/j/40zj2/lma-your-face-is-for-my-abuse_thumb_0.jpg) (http://pimpandhost.com/image/59241064-original.html)

Download Links:

lma-your-face-is-for-my-abuse.rar (http://k2s.cc/file/88e16cdf3025c)
Title: lma you should try it girlfriend
Post by: squidmanheis on January 26, 2017, 01:56:29 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/i/40zia/lma-you-should-try-it-girlfriend_cover.jpg) (http://pimpandhost.com/image/59241010-original.html)

File Name : lma-you-should-try-it-girlfriend
Runtime : 3min 44s
File Size : 82.2 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/i/40zif/lma-you-should-try-it-girlfriend_thumb_0.jpg) (http://pimpandhost.com/image/59241015-original.html)

Download Links:

lma-you-should-try-it-girlfriend.rar (http://k2s.cc/file/6d08a74213c08)
Title: lmf auntpaigevisit cleanmysweatyfeetkenny
Post by: squidmanheis on January 26, 2017, 05:21:20 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/k/40zkc/lmf-auntpaigevisit-cleanmysweatyfeetkenny_cover.jpg) (http://pimpandhost.com/image/59241136-original.html)

File Name : lmf-auntpaigevisit-cleanmysweatyfeetkenny
Runtime : 6min 6s
File Size : 134 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/k/40zkq/lmf-auntpaigevisit-cleanmysweatyfeetkenny_thumb_0.jpg) (http://pimpandhost.com/image/59241150-original.html)

Download Links:

lmf-auntpaigevisit-cleanmysweatyfeetkenny.rar (http://k2s.cc/file/9b2f5dfcdc59a)
Title: lmf bound bootandfootlicker
Post by: squidmanheis on January 26, 2017, 08:46:19 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/o/40zoR/lmf-bound-bootandfootlicker_cover.jpg) (http://pimpandhost.com/image/59241425-original.html)

File Name : lmf-bound-bootandfootlicker
Runtime : 6min 5s
File Size : 134 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/o/40zoU/lmf-bound-bootandfootlicker_thumb_0.jpg) (http://pimpandhost.com/image/59241428-original.html)

Download Links:

lmf-bound-bootandfootlicker.rar (http://k2s.cc/file/0cb873bd5a08f)
Title: lmf crave all of me
Post by: squidmanheis on January 27, 2017, 12:11:18 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/q/40zqe/lmf-crave-all-of-me_cover.jpg) (http://pimpandhost.com/image/59241510-original.html)

File Name : lmf-crave-all-of-me
Runtime : 3min 54s
File Size : 85.7 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/q/40zqh/lmf-crave-all-of-me_thumb_0.jpg) (http://pimpandhost.com/image/59241513-original.html)

Download Links:

lmf-crave-all-of-me.rar (http://k2s.cc/file/d4f2cdcbcfbc9)
Title: lmf crush the bosses face
Post by: squidmanheis on January 27, 2017, 03:36:16 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/r/40zr7/lmf-crush-the-bosses-face_cover.jpg) (http://pimpandhost.com/image/59241565-original.html)

File Name : lmf-crush-the-bosses-face
Runtime : 8min 50s
File Size : 194 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/r/40zrb/lmf-crush-the-bosses-face_thumb_0.jpg) (http://pimpandhost.com/image/59241569-original.html)

Download Links:

lmf-crush-the-bosses-face.rar (http://k2s.cc/file/06d92954a6089)
Title: lmf face the domination
Post by: squidmanheis on January 27, 2017, 07:01:16 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/s/40zsu/lmf-face-the-domination_cover.jpg) (http://pimpandhost.com/image/59241650-original.html)

File Name : lmf-face-the-domination
Runtime : 7min 51s
File Size : 172 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/s/40zsv/lmf-face-the-domination_thumb_0.jpg) (http://pimpandhost.com/image/59241651-original.html)

Download Links:

lmf-face-the-domination.rar (http://k2s.cc/file/522733fa555fb)
Title: lmf sniff the pungent aroma
Post by: squidmanheis on January 27, 2017, 10:26:17 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/s/40zsO/lmf-sniff-the-pungent-aroma_cover.jpg) (http://pimpandhost.com/image/59241670-original.html)

File Name : lmf-sniff-the-pungent-aroma
Runtime : 6min 27s
File Size : 142 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/s/40zsP/lmf-sniff-the-pungent-aroma_thumb_0.jpg) (http://pimpandhost.com/image/59241671-original.html)

Download Links:

lmf-sniff-the-pungent-aroma.rar (http://k2s.cc/file/08eff2a383cbb)
Title: may07hr01
Post by: squidmanheis on January 27, 2017, 01:51:17 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/t/40zti/may07hr01_cover.jpg) (http://pimpandhost.com/image/59241700-original.html)

File Name : may07hr01
Runtime : 3min 48s
File Size : 79.6 MB
File Type: wmv
Resolution : 600x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/t/40ztj/may07hr01_thumb_0.jpg) (http://pimpandhost.com/image/59241701-original.html)

Download Links:

may07hr01.rar (http://k2s.cc/file/d4d888e56cd66)
Title: nov07hr03
Post by: squidmanheis on January 27, 2017, 05:16:16 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/t/40zts/nov07hr03_cover.jpg) (http://pimpandhost.com/image/59241710-original.html)

File Name : nov07hr03
Runtime : 5min 2s
File Size : 113 MB
File Type: wmv
Resolution : 600x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/t/40ztu/nov07hr03_thumb_0.jpg) (http://pimpandhost.com/image/59241712-original.html)

Download Links:

nov07hr03.rar (http://k2s.cc/file/efd62657c7d20)
Title: rw aunt paige has a shoulderride
Post by: squidmanheis on January 27, 2017, 08:41:15 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/t/40ztF/rw-aunt-paige-has-a-shoulderride_cover.jpg) (http://pimpandhost.com/image/59241723-original.html)

File Name : rw-aunt-paige-has-a-shoulderride
Runtime : 5min 25s
File Size : 119 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/t/40ztH/rw-aunt-paige-has-a-shoulderride_thumb_0.jpg) (http://pimpandhost.com/image/59241725-original.html)

Download Links:

rw-aunt-paige-has-a-shoulderride.rar (http://k2s.cc/file/cec8ddb325947)
Title: rw boots spurs whips pain
Post by: squidmanheis on January 28, 2017, 12:06:11 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/t/40ztS/rw-boots-spurs-whips-pain_cover.jpg) (http://pimpandhost.com/image/59241736-original.html)

File Name : rw-boots-spurs-whips-pain
Runtime : 5min 13s
File Size : 115 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/t/40ztT/rw-boots-spurs-whips-pain_thumb_0.jpg) (http://pimpandhost.com/image/59241737-original.html)

Download Links:

rw-boots-spurs-whips-pain.rar (http://k2s.cc/file/9d42a58c4e937)
Title: rw city shoulder ride
Post by: squidmanheis on January 28, 2017, 03:31:17 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/u/40zu5/rw-city-shoulder-ride_cover.jpg) (http://pimpandhost.com/image/59241749-original.html)

File Name : rw-city-shoulder-ride
Runtime : 8min 11s
File Size : 180 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/u/40zu6/rw-city-shoulder-ride_thumb_0.jpg) (http://pimpandhost.com/image/59241750-original.html)

Download Links:

rw-city-shoulder-ride.rar (http://k2s.cc/file/9a9ba5b203724)
Title: rw cruel riding jasmine
Post by: squidmanheis on January 28, 2017, 06:56:32 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/u/40zun/rw-cruel-riding-jasmine_cover.jpg) (http://pimpandhost.com/image/59241767-original.html)

File Name : rw-cruel-riding-jasmine
Runtime : 6min 29s
File Size : 142 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/u/40zur/rw-cruel-riding-jasmine_thumb_0.jpg) (http://pimpandhost.com/image/59241771-original.html)

Download Links:

rw-cruel-riding-jasmine.rar (http://k2s.cc/file/f38ade3d45a6f)
Title: rw do not fail mistress p01
Post by: squidmanheis on January 28, 2017, 10:21:14 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/v/40zvm/rw-do-not-fail-mistress-p01_cover.jpg) (http://pimpandhost.com/image/59241828-original.html)

File Name : rw-do-not-fail-mistress-p01
Runtime : 7min 47s
File Size : 171 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/v/40zvo/rw-do-not-fail-mistress-p01_thumb_0.jpg) (http://pimpandhost.com/image/59241830-original.html)

Download Links:

rw-do-not-fail-mistress-p01.rar (http://k2s.cc/file/a1411dc4be136)
Title: rw i spur you obey
Post by: squidmanheis on January 28, 2017, 01:46:03 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/w/40zwr/rw-i-spur-you-obey_cover.jpg) (http://pimpandhost.com/image/59241895-original.html)

File Name : rw-i-spur-you-obey
Runtime : 10min 42s
File Size : 235 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/w/40zwt/rw-i-spur-you-obey_thumb_0.jpg) (http://pimpandhost.com/image/59241897-original.html)

Download Links:

rw-i-spur-you-obey.rar (http://k2s.cc/file/b296e522b8ecc)
Title: rw melodys 2 legged ride
Post by: squidmanheis on January 28, 2017, 05:11:02 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/x/40zxj/rw-melodys-2-legged-ride_cover.jpg) (http://pimpandhost.com/image/59241949-original.html)

File Name : rw-melodys-2-legged-ride
Runtime : 4min 26s
File Size : 97.8 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/x/40zxm/rw-melodys-2-legged-ride_thumb_0.jpg) (http://pimpandhost.com/image/59241952-original.html)

Download Links:

rw-melodys-2-legged-ride.rar (http://k2s.cc/file/e8b57777b01e1)
Title: rw vicious spurs of cruel countess
Post by: squidmanheis on January 28, 2017, 08:36:03 pm

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/x/40zxF/rw-vicious-spurs-of-cruel-countess_cover.jpg) (http://pimpandhost.com/image/59241971-original.html)

File Name : rw-vicious-spurs-of-cruel-countess
Runtime : 8min 2s
File Size : 177 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/x/40zxG/rw-vicious-spurs-of-cruel-countess_thumb_0.jpg) (http://pimpandhost.com/image/59241972-original.html)

Download Links:

rw-vicious-spurs-of-cruel-countess.rar (http://k2s.cc/file/e68b62afad688)
Title: sep07hr04
Post by: squidmanheis on January 29, 2017, 03:27:28 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/y/40zyT/sep07hr04_cover.jpg) (http://pimpandhost.com/image/59242047-original.html)

File Name : sep07hr04
Runtime : 2min 44s
File Size : 55.4 MB
File Type: wmv
Resolution : 600x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/y/40zyU/sep07hr04_thumb_0.jpg) (http://pimpandhost.com/image/59242048-original.html)

Download Links:

sep07hr04.rar (http://k2s.cc/file/64cd734ffab54)
Title: sep07hr05
Post by: squidmanheis on January 29, 2017, 06:51:01 am

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/z/40zz4/sep07hr05_cover.jpg) (http://pimpandhost.com/image/59242058-original.html)

File Name : sep07hr05
Runtime : 3min 25s
File Size : 69.2 MB
File Type: wmv
Resolution : 600x480

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/z/40zz5/sep07hr05_thumb_0.jpg) (http://pimpandhost.com/image/59242059-original.html)

Download Links:

sep07hr05.rar (http://k2s.cc/file/e5bfc955bfeda)
Title: Smother 025b Kaitlynn Destiny
Post by: squidmanheis on January 29, 2017, 10:16:01 am
Smother 025b - Kaitlynn   Destiny

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/z/40zzg/Smother%20025b%20-%20Kaitlynn%20%20%20Destiny_cover.jpg) (http://pimpandhost.com/image/59242070-original.html)

File Name : Smother 025b - Kaitlynn   Destiny
Runtime : 31min 46s
File Size : 316 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/z/40zzh/Smother%20025b%20-%20Kaitlynn%20%20%20Destiny_thumb_0.jpg) (http://pimpandhost.com/image/59242071-original.html)

Download Links:

Smother 025b - Kaitlynn   Destiny.rar (http://k2s.cc/file/6067c99eca5b5)
Title: Smother 042a
Post by: squidmanheis on January 29, 2017, 01:41:42 pm
Smother 042a

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/A/40zAN/Smother%20042a_cover.jpg) (http://pimpandhost.com/image/59242165-original.html)

File Name : Smother 042a
Runtime : 34min 9s
File Size : 293 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/A/40zAQ/Smother%20042a_thumb_0.jpg) (http://pimpandhost.com/image/59242168-original.html)

Download Links:

Smother 042a.rar (http://k2s.cc/file/90334cd00737c)
Title: Smother 042a
Post by: squidmanheis on January 29, 2017, 01:42:19 pm
Smother 042a

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/A/40zAN/Smother%20042a_cover.jpg) (http://pimpandhost.com/image/59242165-original.html)

File Name : Smother 042a
Runtime : 34min 9s
File Size : 293 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/A/40zAQ/Smother%20042a_thumb_0.jpg) (http://pimpandhost.com/image/59242168-original.html)

Download Links:

Smother 042a.rar (http://k2s.cc/file/90334cd00737c)
Title: Smother 064a Kaitlynn
Post by: squidmanheis on January 29, 2017, 05:06:07 pm
Smother 064a - Kaitlynn

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/D/40zDM/Smother%20064a%20-%20Kaitlynn_cover.jpg) (http://pimpandhost.com/image/59242350-original.html)

File Name : Smother 064a - Kaitlynn
Runtime : 30min 51s
File Size : 288 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/D/40zDO/Smother%20064a%20-%20Kaitlynn_thumb_0.jpg) (http://pimpandhost.com/image/59242352-original.html)

Download Links:

Smother 064a - Kaitlynn.rar (http://k2s.cc/file/f5ce74a6e07da)
Title: Smother 064b Eve
Post by: squidmanheis on January 29, 2017, 08:31:03 pm
Smother 064b - Eve

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/H/40zHm/Smother%20064b%20-%20Eve_cover.jpg) (http://pimpandhost.com/image/59242572-original.html)

File Name : Smother 064b - Eve
Runtime : 32min 1s
File Size : 288 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/H/40zHq/Smother%20064b%20-%20Eve_thumb_0.jpg) (http://pimpandhost.com/image/59242576-original.html)

Download Links:

Smother 064b - Eve.rar (http://k2s.cc/file/986bab9b9fea8)
Title: Smother 069a Kelly Crystal
Post by: squidmanheis on January 29, 2017, 11:56:04 pm
Smother 069a - Kelly   Crystal

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/L/40zLa/Smother%20069a%20-%20Kelly%20%20%20Crystal_cover.jpg) (http://pimpandhost.com/image/59242808-original.html)

File Name : Smother 069a - Kelly   Crystal
Runtime : 31min 8s
File Size : 241 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/L/40zLe/Smother%20069a%20-%20Kelly%20%20%20Crystal_thumb_0.jpg) (http://pimpandhost.com/image/59242812-original.html)

Download Links:

Smother 069a - Kelly   Crystal.rar (http://k2s.cc/file/bdf799735296d)
Title: Smother 088b Tanya
Post by: squidmanheis on January 30, 2017, 03:02:54 pm
Smother 088b - Tanya

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/N/40zN0/Smother%20088b%20-%20Tanya_cover.jpg) (http://pimpandhost.com/image/59242922-original.html)

File Name : Smother 088b - Tanya
Runtime : 29min 52s
File Size : 263 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/N/40zN4/Smother%20088b%20-%20Tanya_thumb_0.jpg) (http://pimpandhost.com/image/59242926-original.html)

Download Links:

Smother 088b - Tanya.rar (http://k2s.cc/file/3355b73aa8e93)
Title: Smother 090a Stacy
Post by: squidmanheis on January 30, 2017, 06:27:51 pm
Smother 090a - Stacy

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/O/40zOS/Smother%20090a%20-%20Stacy_cover.jpg) (http://pimpandhost.com/image/59243038-original.html)

File Name : Smother 090a - Stacy
Runtime : 31min 34s
File Size : 255 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/O/40zOW/Smother%20090a%20-%20Stacy_thumb_0.jpg) (http://pimpandhost.com/image/59243042-original.html)

Download Links:

Smother 090a - Stacy.rar (http://k2s.cc/file/d67c1194caa5e)
Title: Smother 094b
Post by: squidmanheis on January 30, 2017, 09:52:54 pm
Smother 094b

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/Q/40zQk/Smother%20094b_cover.jpg) (http://pimpandhost.com/image/59243128-original.html)

File Name : Smother 094b
Runtime : 30min 23s
File Size : 283 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/Q/40zQm/Smother%20094b_thumb_0.jpg) (http://pimpandhost.com/image/59243130-original.html)

Download Links:

Smother 094b.rar (http://k2s.cc/file/d8b63bfe705e9)
Title: Smother 096a Andrea Crystal
Post by: squidmanheis on January 31, 2017, 01:18:10 am
Smother 096a - Andrea   Crystal

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/R/40zRb/Smother%20096a%20-%20Andrea%20%20%20Crystal_cover.jpg) (http://pimpandhost.com/image/59243181-original.html)

File Name : Smother 096a - Andrea   Crystal
Runtime : 31min 59s
File Size : 283 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/R/40zRc/Smother%20096a%20-%20Andrea%20%20%20Crystal_thumb_0.jpg) (http://pimpandhost.com/image/59243182-original.html)

Download Links:

Smother 096a - Andrea   Crystal.rar (http://k2s.cc/file/b1085d8dae615)
Title: Smother 096b Stacy
Post by: squidmanheis on January 31, 2017, 04:42:52 am
Smother 096b - Stacy

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/R/40zRF/Smother%20096b%20-%20Stacy_cover.jpg) (http://pimpandhost.com/image/59243211-original.html)

File Name : Smother 096b - Stacy
Runtime : 30min 26s
File Size : 234 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/R/40zRH/Smother%20096b%20-%20Stacy_thumb_0.jpg) (http://pimpandhost.com/image/59243213-original.html)

Download Links:

Smother 096b - Stacy.rar (http://k2s.cc/file/a21ca9b7ea205)
Title: Smother 099a Taylor St Claire Chelsea
Post by: squidmanheis on January 31, 2017, 08:07:49 am
Smother 099a - Taylor St  Claire   Chelsea

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/S/40zSJ/Smother%20099a%20-%20Taylor%20St.%20Claire%20%20%20Chelsea_cover.jpg) (http://pimpandhost.com/image/59243277-original.html)

File Name : Smother 099a - Taylor St. Claire   Chelsea
Runtime : 30min 48s
File Size : 299 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/S/40zSM/Smother%20099a%20-%20Taylor%20St.%20Claire%20%20%20Chelsea_thumb_0.jpg) (http://pimpandhost.com/image/59243280-original.html)

Download Links:

Smother 099a - Taylor St. Claire   Chelsea.rar (http://k2s.cc/file/7326853b80cdf)
Title: Smother 100a
Post by: squidmanheis on January 31, 2017, 11:32:48 am
Smother 100a

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/T/40zTi/Smother%20100a_cover.jpg) (http://pimpandhost.com/image/59243312-original.html)

File Name : Smother 100a
Runtime : 30min 34s
File Size : 308 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/T/40zTj/Smother%20100a_thumb_0.jpg) (http://pimpandhost.com/image/59243313-original.html)

Download Links:

Smother 100a.rar (http://k2s.cc/file/fd316f72efa94)
Title: Smother 110a
Post by: squidmanheis on January 31, 2017, 02:57:46 pm
Smother 110a

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/T/40zTH/Smother%20110a_cover.jpg) (http://pimpandhost.com/image/59243337-original.html)

File Name : Smother 110a
Runtime : 31min 28s
File Size : 267 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/T/40zTI/Smother%20110a_thumb_0.jpg) (http://pimpandhost.com/image/59243338-original.html)

Download Links:

Smother 110a.rar (http://k2s.cc/file/8bfd1ef85606d)
Title: Smother 113b Micky Lynn Devin
Post by: squidmanheis on January 31, 2017, 06:22:48 pm
Smother 113b - Micky Lynn   Devin

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/U/40zU8/Smother%20113b%20-%20Micky%20Lynn%20%20%20Devin_cover.jpg) (http://pimpandhost.com/image/59243364-original.html)

File Name : Smother 113b - Micky Lynn   Devin
Runtime : 29min 42s
File Size : 306 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/U/40zU9/Smother%20113b%20-%20Micky%20Lynn%20%20%20Devin_thumb_0.jpg) (http://pimpandhost.com/image/59243365-original.html)

Download Links:

Smother 113b - Micky Lynn   Devin.rar (http://k2s.cc/file/048f35b5dd2c2)
Title: Smother 119a Tori
Post by: squidmanheis on January 31, 2017, 09:47:46 pm
Smother 119a - Tori

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/U/40zUU/Smother%20119a%20-%20Tori_cover.jpg) (http://pimpandhost.com/image/59243412-original.html)

File Name : Smother 119a - Tori
Runtime : 28min 49s
File Size : 287 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/U/40zUV/Smother%20119a%20-%20Tori_thumb_0.jpg) (http://pimpandhost.com/image/59243413-original.html)

Download Links:

Smother 119a - Tori.rar (http://k2s.cc/file/6b6d423d03729)
Title: Smother 119b Destiny Kimmee Lee
Post by: squidmanheis on February 01, 2017, 01:12:45 am
Smother 119b - Destiny   Kimmee Lee

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/V/40zV9/Smother%20119b%20-%20Destiny%20%20%20Kimmee%20Lee_cover.jpg) (http://pimpandhost.com/image/59243427-original.html)

File Name : Smother 119b - Destiny   Kimmee Lee
Runtime : 32min 7s
File Size : 248 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/V/40zVa/Smother%20119b%20-%20Destiny%20%20%20Kimmee%20Lee_thumb_0.jpg) (http://pimpandhost.com/image/59243428-original.html)

Download Links:

Smother 119b - Destiny   Kimmee Lee.rar (http://k2s.cc/file/23e8994c3f621)
Title: Smother 121b Eve Tasha
Post by: squidmanheis on February 01, 2017, 04:37:43 am
Smother 121b - Eve   Tasha

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/V/40zVA/Smother%20121b%20-%20Eve%20%20%20Tasha_cover.jpg) (http://pimpandhost.com/image/59243454-original.html)

File Name : Smother 121b - Eve   Tasha
Runtime : 31min 12s
File Size : 292 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/V/40zVB/Smother%20121b%20-%20Eve%20%20%20Tasha_thumb_0.jpg) (http://pimpandhost.com/image/59243455-original.html)

Download Links:

Smother 121b - Eve   Tasha.rar (http://k2s.cc/file/f97c39e64a036)
Title: Smother 126a Kelly ODell Felicia
Post by: squidmanheis on February 01, 2017, 08:02:41 am
Smother 126a - Kelly ODell   Felicia

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/W/40zW6/Smother%20126a%20-%20Kelly%20ODell%20%20%20Felicia_cover.jpg) (http://pimpandhost.com/image/59243486-original.html)

File Name : Smother 126a - Kelly ODell   Felicia
Runtime : 30min 23s
File Size : 269 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/W/40zW7/Smother%20126a%20-%20Kelly%20ODell%20%20%20Felicia_thumb_0.jpg) (http://pimpandhost.com/image/59243487-original.html)

Download Links:

Smother 126a - Kelly ODell   Felicia.rar (http://k2s.cc/file/c895af74dc17d)
Title: Smother 126b Kaitlynn Jaimee
Post by: squidmanheis on February 01, 2017, 11:27:39 am
Smother 126b - Kaitlynn   Jaimee

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/W/40zWk/Smother%20126b%20-%20Kaitlynn%20%20%20Jaimee_cover.jpg) (http://pimpandhost.com/image/59243500-original.html)

File Name : Smother 126b - Kaitlynn   Jaimee
Runtime : 31min 17s
File Size : 288 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/W/40zWm/Smother%20126b%20-%20Kaitlynn%20%20%20Jaimee_thumb_0.jpg) (http://pimpandhost.com/image/59243502-original.html)

Download Links:

Smother 126b - Kaitlynn   Jaimee.rar (http://k2s.cc/file/30a071708cc26)
Title: Smother 128a Tanya Jordan
Post by: squidmanheis on February 01, 2017, 02:52:37 pm
Smother 128a - Tanya   Jordan

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/W/40zWE/Smother%20128a%20-%20Tanya%20%20%20Jordan_cover.jpg) (http://pimpandhost.com/image/59243520-original.html)

File Name : Smother 128a - Tanya   Jordan
Runtime : 32min 34s
File Size : 256 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/W/40zWF/Smother%20128a%20-%20Tanya%20%20%20Jordan_thumb_0.jpg) (http://pimpandhost.com/image/59243521-original.html)

Download Links:

Smother 128a - Tanya   Jordan.rar (http://k2s.cc/file/fa391a63d10cf)
Title: Smother 131a Crystal Angela
Post by: squidmanheis on February 01, 2017, 06:17:37 pm
Smother 131a - Crystal   Angela

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/W/40zWT/Smother%20131a%20-%20Crystal%20%20%20Angela_cover.jpg) (http://pimpandhost.com/image/59243535-original.html)

File Name : Smother 131a - Crystal   Angela
Runtime : 32min 28s
File Size : 277 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/W/40zWU/Smother%20131a%20-%20Crystal%20%20%20Angela_thumb_0.jpg) (http://pimpandhost.com/image/59243536-original.html)

Download Links:

Smother 131a - Crystal   Angela.rar (http://k2s.cc/file/e4201e8debc36)
Title: Smother 131b Jordan Tanya
Post by: squidmanheis on February 01, 2017, 09:42:25 pm
Smother 131b - Jordan   Tanya

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/X/40zXl/Smother%20131b%20-%20Jordan%20%20%20Tanya_cover.jpg) (http://pimpandhost.com/image/59243563-original.html)

File Name : Smother 131b - Jordan   Tanya
Runtime : 31min 48s
File Size : 274 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/X/40zXm/Smother%20131b%20-%20Jordan%20%20%20Tanya_thumb_0.jpg) (http://pimpandhost.com/image/59243564-original.html)

Download Links:

Smother 131b - Jordan   Tanya.rar (http://k2s.cc/file/a9622b09f6c8f)
Title: Smother 132a Devin Micah
Post by: squidmanheis on February 02, 2017, 01:07:31 am
Smother 132a - Devin   Micah

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/X/40zXu/Smother%20132a%20-%20Devin%20%20%20Micah_cover.jpg) (http://pimpandhost.com/image/59243572-original.html)

File Name : Smother 132a - Devin   Micah
Runtime : 30min 57s
File Size : 272 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/X/40zXv/Smother%20132a%20-%20Devin%20%20%20Micah_thumb_0.jpg) (http://pimpandhost.com/image/59243573-original.html)

Download Links:

Smother 132a - Devin   Micah.rar (http://k2s.cc/file/604d189342f03)
Title: Smother 132b Angel Jaimee
Post by: squidmanheis on February 02, 2017, 04:32:32 am
Smother 132b - Angel   Jaimee

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/X/40zXC/Smother%20132b%20-%20Angel%20%20%20Jaimee_cover.jpg) (http://pimpandhost.com/image/59243580-original.html)

File Name : Smother 132b - Angel   Jaimee
Runtime : 33min 16s
File Size : 272 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/X/40zXD/Smother%20132b%20-%20Angel%20%20%20Jaimee_thumb_0.jpg) (http://pimpandhost.com/image/59243581-original.html)

Download Links:

Smother 132b - Angel   Jaimee.rar (http://k2s.cc/file/df1bbef03b97a)
Title: Smother 133b Stacy Jaimee
Post by: squidmanheis on February 02, 2017, 07:57:29 am
Smother 133b - Stacy   Jaimee

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/Y/40zYA/Smother%20133b%20-%20Stacy%20%20%20Jaimee_cover.jpg) (http://pimpandhost.com/image/59243640-original.html)

File Name : Smother 133b - Stacy   Jaimee
Runtime : 30min 57s
File Size : 270 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/Y/40zYB/Smother%20133b%20-%20Stacy%20%20%20Jaimee_thumb_0.jpg) (http://pimpandhost.com/image/59243641-original.html)

Download Links:

Smother 133b - Stacy   Jaimee.rar (http://k2s.cc/file/6b483d160c6f5)
Title: Smother 134b Nikki Nova Jordan Scott
Post by: squidmanheis on February 02, 2017, 11:22:32 am
Smother 134b - Nikki Nova   Jordan Scott

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/Z/40zZP/Smother%20134b%20-%20Nikki%20Nova%20%20%20Jordan%20Scott_cover.jpg) (http://pimpandhost.com/image/59243717-original.html)

File Name : Smother 134b - Nikki Nova   Jordan Scott
Runtime : 31min 48s
File Size : 233 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/z/Z/40zZT/Smother%20134b%20-%20Nikki%20Nova%20%20%20Jordan%20Scott_thumb_0.jpg) (http://pimpandhost.com/image/59243721-original.html)

Download Links:

Smother 134b - Nikki Nova   Jordan Scott.rar (http://k2s.cc/file/f3718a6cd65b1)
Title: Smother 136a Chelsea Micah
Post by: squidmanheis on February 02, 2017, 02:47:26 pm
Smother 136a - Chelsea   Micah

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/2/40A2e/Smother%20136a%20-%20Chelsea%20%20%20Micah_cover.jpg) (http://pimpandhost.com/image/59243866-original.html)

File Name : Smother 136a - Chelsea   Micah
Runtime : 30min 44s
File Size : 234 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/2/40A2g/Smother%20136a%20-%20Chelsea%20%20%20Micah_thumb_0.jpg) (http://pimpandhost.com/image/59243868-original.html)

Download Links:

Smother 136a - Chelsea   Micah.rar (http://k2s.cc/file/3b3bd7538d7e0)
Title: Smother 136b Molina
Post by: squidmanheis on February 02, 2017, 06:12:25 pm
Smother 136b - Molina

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/3/40A3C/Smother%20136b%20-%20Molina_cover.jpg) (http://pimpandhost.com/image/59243952-original.html)

File Name : Smother 136b - Molina
Runtime : 29min 45s
File Size : 256 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/3/40A3E/Smother%20136b%20-%20Molina_thumb_0.jpg) (http://pimpandhost.com/image/59243954-original.html)

Download Links:

Smother 136b - Molina.rar (http://k2s.cc/file/5fcb74c05a341)
Title: Smother 139a Kaitlynn Jewel
Post by: squidmanheis on February 02, 2017, 09:37:23 pm
Smother 139a - Kaitlynn   Jewel

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/5/40A58/Smother%20139a%20-%20Kaitlynn%20%20%20Jewel_cover.jpg) (http://pimpandhost.com/image/59244046-original.html)

File Name : Smother 139a - Kaitlynn   Jewel
Runtime : 31min 29s
File Size : 259 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/5/40A59/Smother%20139a%20-%20Kaitlynn%20%20%20Jewel_thumb_0.jpg) (http://pimpandhost.com/image/59244047-original.html)

Download Links:

Smother 139a - Kaitlynn   Jewel.rar (http://k2s.cc/file/284506faaa903)
Title: Smother 139b Stacy Goldy
Post by: squidmanheis on February 03, 2017, 01:02:22 am
Smother 139b - Stacy   Goldy

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/5/40A5S/Smother%20139b%20-%20Stacy%20%20%20Goldy_cover.jpg) (http://pimpandhost.com/image/59244092-original.html)

File Name : Smother 139b - Stacy   Goldy
Runtime : 30min 53s
File Size : 269 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/5/40A5T/Smother%20139b%20-%20Stacy%20%20%20Goldy_thumb_0.jpg) (http://pimpandhost.com/image/59244093-original.html)

Download Links:

Smother 139b - Stacy   Goldy.rar (http://k2s.cc/file/320eb18c346b0)
Title: Smother 141a Kaitlynn Jaimee
Post by: squidmanheis on February 03, 2017, 04:27:21 am
Smother 141a - Kaitlynn   Jaimee

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/6/40A6u/Smother%20141a%20-%20Kaitlynn%20%20%20Jaimee_cover.jpg) (http://pimpandhost.com/image/59244130-original.html)

File Name : Smother 141a - Kaitlynn   Jaimee
Runtime : 31min 37s
File Size : 315 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/6/40A6v/Smother%20141a%20-%20Kaitlynn%20%20%20Jaimee_thumb_0.jpg) (http://pimpandhost.com/image/59244131-original.html)

Download Links:

Smother 141a - Kaitlynn   Jaimee.rar (http://k2s.cc/file/9d1726aa3d960)
Title: Smother 141b Crystal Georgianne
Post by: squidmanheis on February 03, 2017, 07:52:18 am
Smother 141b - Crystal   Georgianne

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/7/40A7N/Smother%20141b%20-%20Crystal%20%20%20Georgianne_cover.jpg) (http://pimpandhost.com/image/59244211-original.html)

File Name : Smother 141b - Crystal   Georgianne
Runtime : 32min 21s
File Size : 257 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/7/40A7O/Smother%20141b%20-%20Crystal%20%20%20Georgianne_thumb_0.jpg) (http://pimpandhost.com/image/59244212-original.html)

Download Links:

Smother 141b - Crystal   Georgianne.rar (http://k2s.cc/file/1d290f2af9808)
Title: Smother 142a Stacy Micah
Post by: squidmanheis on February 03, 2017, 11:17:21 am
Smother 142a - Stacy   Micah

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/8/40A8R/Smother%20142a%20-%20Stacy%20%20%20Micah_cover.jpg) (http://pimpandhost.com/image/59244277-original.html)

File Name : Smother 142a - Stacy   Micah
Runtime : 27min 47s
File Size : 256 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/8/40A8T/Smother%20142a%20-%20Stacy%20%20%20Micah_thumb_0.jpg) (http://pimpandhost.com/image/59244279-original.html)

Download Links:

Smother 142a - Stacy   Micah.rar (http://k2s.cc/file/f6b7343b841a6)
Title: Smother 148a Goldy
Post by: squidmanheis on February 03, 2017, 02:42:20 pm
Smother 148a - Goldy

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/9/40A9v/Smother%20148a%20-%20Goldy_cover.jpg) (http://pimpandhost.com/image/59244317-original.html)

File Name : Smother 148a - Goldy
Runtime : 31min 53s
File Size : 323 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/9/40A9w/Smother%20148a%20-%20Goldy_thumb_0.jpg) (http://pimpandhost.com/image/59244318-original.html)

Download Links:

Smother 148a - Goldy.rar (http://k2s.cc/file/a750274111fb2)
Title: Smother 148b
Post by: squidmanheis on February 03, 2017, 06:07:12 pm
Smother 148b

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/a/40Aak/Smother%20148b_cover.jpg) (http://pimpandhost.com/image/59244368-original.html)

File Name : Smother 148b
Runtime : 30min 30s
File Size : 313 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/a/40Aaq/Smother%20148b_thumb_0.jpg) (http://pimpandhost.com/image/59244374-original.html)

Download Links:

Smother 148b.rar (http://k2s.cc/file/1d3bbdb9f15d6)
Title: Smother 149a Andrea Stacy
Post by: squidmanheis on February 03, 2017, 09:32:10 pm
Smother 149a - Andrea   Stacy

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/b/40Ab8/Smother%20149a%20-%20Andrea%20%20%20Stacy_cover.jpg) (http://pimpandhost.com/image/59244418-original.html)

File Name : Smother 149a - Andrea   Stacy
Runtime : 31min 32s
File Size : 277 MB
File Type: wmv
Resolution : 320x240

(http://ist3-3.filesor.com/pimpandhost.com/1/2/4/5/124593/4/0/A/b/40Ab9/Smother%20149a%20-%20Andrea%20%20%20Stacy_thumb_0.jpg) (http://pimpandhost.com/image/59244419-original.html)

Download Links:

Smother 149a - Andrea   Stacy.rar (http://k2s.cc/file/b335a1e59aec8)
Title: Facesitting 001 003 anya
Post by: squidmanheis on February 14, 2017, 11:52:03 pm
Facesitting 001-003 anya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/1/4cM1r/Facesitting%20001-003%20anya_cover.jpg) (http://pimpandhost.com/image/62149881)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 001-003 anya
Runtime : 19min 2s
File Size : 145 MB
File Type: asf
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/1/4cM1s/Facesitting%20001-003%20anya_thumb_0.jpg) (http://pimpandhost.com/image/62149882)

Download Links:

Facesitting 001-003 anya.rar (http://k2s.cc/file/17e0eaa6b069b)
Title: Facesitting 004 006 alice
Post by: squidmanheis on February 15, 2017, 03:17:07 am
Facesitting 004-006 alice

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/2/4cM25/Facesitting%20004-006%20alice_cover.jpg) (http://pimpandhost.com/image/62149921)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 004-006 alice
Runtime : 19min 24s
File Size : 148 MB
File Type: asf
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/2/4cM26/Facesitting%20004-006%20alice_thumb_0.jpg) (http://pimpandhost.com/image/62149922)

Download Links:

Facesitting 004-006 alice.rar (http://k2s.cc/file/17a544cceb410)
Title: Facesitting 007 009 alice tanya
Post by: squidmanheis on February 15, 2017, 06:42:03 am
Facesitting 007-009 alice tanya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/2/4cM2H/Facesitting%20007-009%20alice%20tanya_cover.jpg) (http://pimpandhost.com/image/62149959)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 007-009 alice tanya
Runtime : 18min 36s
File Size : 142 MB
File Type: asf
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/2/4cM2J/Facesitting%20007-009%20alice%20tanya_thumb_0.jpg) (http://pimpandhost.com/image/62149961)

Download Links:

Facesitting 007-009 alice tanya.rar (http://k2s.cc/file/80eee3578ac36)
Title: Facesitting 010 011 zara
Post by: squidmanheis on February 15, 2017, 10:06:50 am
Facesitting 010-011 zara

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/3/4cM3e/Facesitting%20010-011%20zara_cover.jpg) (http://pimpandhost.com/image/62149992)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 010-011 zara
Runtime : 13min 15s
File Size : 101 MB
File Type: asf
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/3/4cM3i/Facesitting%20010-011%20zara_thumb_0.jpg) (http://pimpandhost.com/image/62149996)

Download Links:

Facesitting 010-011 zara.rar (http://k2s.cc/file/192890fcc5dd7)
Title: Facesitting 012 014 irina katya
Post by: squidmanheis on February 15, 2017, 01:32:00 pm
Facesitting 012-014 irina katya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/3/4cM3G/Facesitting%20012-014%20irina%20katya_cover.jpg) (http://pimpandhost.com/image/62150020)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 012-014 irina katya
Runtime : 17min 56s
File Size : 137 MB
File Type: asf
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/3/4cM3J/Facesitting%20012-014%20irina%20katya_thumb_0.jpg) (http://pimpandhost.com/image/62150023)

Download Links:

Facesitting 012-014 irina katya.rar (http://k2s.cc/file/1792b3fcbe311)
Title: Facesitting 015 016 anya arina
Post by: squidmanheis on February 15, 2017, 04:56:58 pm
Facesitting 015-016 anya arina

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/4/4cM4h/Facesitting%20015-016%20anya%20arina_cover.jpg) (http://pimpandhost.com/image/62150057)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 015-016 anya arina
Runtime : 12min 19s
File Size : 93.8 MB
File Type: asf
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/4/4cM4n/Facesitting%20015-016%20anya%20arina_thumb_0.jpg) (http://pimpandhost.com/image/62150063)

Download Links:

Facesitting 015-016 anya arina.rar (http://k2s.cc/file/0585328f7456a)
Title: Facesitting 017 019 irina ksusha
Post by: squidmanheis on February 15, 2017, 08:21:57 pm
Facesitting 017-019 irina ksusha

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/4/4cM4N/Facesitting%20017-019%20irina%20ksusha_cover.jpg) (http://pimpandhost.com/image/62150089)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 017-019 irina ksusha
Runtime : 20min 22s
File Size : 155 MB
File Type: asf
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/4/4cM4P/Facesitting%20017-019%20irina%20ksusha_thumb_0.jpg) (http://pimpandhost.com/image/62150091)

Download Links:

Facesitting 017-019 irina ksusha.rar (http://k2s.cc/file/37757f6ea8171)
Title: Facesitting 020anna
Post by: squidmanheis on February 15, 2017, 11:47:00 pm
Facesitting 020anna

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/8/4cM83/Facesitting%20020anna_cover.jpg) (http://pimpandhost.com/image/62150291)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 020anna
Runtime : 6min 0s
File Size : 45.7 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/8/4cM84/Facesitting%20020anna_thumb_0.jpg) (http://pimpandhost.com/image/62150292)

Download Links:

Facesitting 020anna.rar (http://k2s.cc/file/f68aeb96e1fae)
Title: Facesitting 023 024 tanya lara
Post by: squidmanheis on February 16, 2017, 03:12:01 am
Facesitting 023-024 tanya lara

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/8/4cM8M/Facesitting%20023-024%20tanya%20lara_cover.jpg) (http://pimpandhost.com/image/62150336)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 023-024 tanya lara
Runtime : 16min 18s
File Size : 124 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/8/4cM8N/Facesitting%20023-024%20tanya%20lara_thumb_0.jpg) (http://pimpandhost.com/image/62150337)

Download Links:

Facesitting 023-024 tanya lara.rar (http://k2s.cc/file/0e028b684fcf4)
Title: Facesitting 025 026 jenya alice
Post by: squidmanheis on February 16, 2017, 06:36:58 am
Facesitting 025-026 jenya alice

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/9/4cM9W/Facesitting%20025-026%20jenya%20alice_cover.jpg) (http://pimpandhost.com/image/62150408)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 025-026 jenya alice
Runtime : 10min 1s
File Size : 76.4 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/9/4cM9Z/Facesitting%20025-026%20jenya%20alice_thumb_0.jpg) (http://pimpandhost.com/image/62150411)

Download Links:

Facesitting 025-026 jenya alice.rar (http://k2s.cc/file/371a1deaaeb8e)
Title: Facesitting 027 028 anna gold irina
Post by: squidmanheis on February 16, 2017, 10:01:58 am
Facesitting 027-028 anna gold irina

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/a/4cMaE/Facesitting%20027-028%20anna%20gold%20irina_cover.jpg) (http://pimpandhost.com/image/62150452)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 027-028 anna gold irina
Runtime : 13min 5s
File Size : 99.6 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/a/4cMaF/Facesitting%20027-028%20anna%20gold%20irina_thumb_0.jpg) (http://pimpandhost.com/image/62150453)

Download Links:

Facesitting 027-028 anna gold irina.rar (http://k2s.cc/file/29b5406d89c4d)
Title: Facesitting 029 031 katya yuliya
Post by: squidmanheis on February 16, 2017, 01:26:59 pm
Facesitting 029-031 katya yuliya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/b/4cMbF/Facesitting%20029-031%20katya%20yuliya_cover.jpg) (http://pimpandhost.com/image/62150515)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 029-031 katya yuliya
Runtime : 19min 19s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/b/4cMbK/Facesitting%20029-031%20katya%20yuliya_thumb_0.jpg) (http://pimpandhost.com/image/62150520)

Download Links:

Facesitting 029-031 katya yuliya.rar (http://k2s.cc/file/a63410441b305)
Title: Facesitting 033 034 anya irina
Post by: squidmanheis on February 16, 2017, 04:52:00 pm
Facesitting 033-034 anya irina

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/d/4cMdz/Facesitting%20033-034%20anya%20irina_cover.jpg) (http://pimpandhost.com/image/62150633)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 033-034 anya irina
Runtime : 14min 45s
File Size : 112 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/d/4cMdK/Facesitting%20033-034%20anya%20irina_thumb_0.jpg) (http://pimpandhost.com/image/62150644)

Download Links:

Facesitting 033-034 anya irina.rar (http://k2s.cc/file/b285e4e0f6800)
Title: Facesitting 035 037 anya mara
Post by: squidmanheis on February 16, 2017, 08:16:59 pm
Facesitting 035-037 anya mara

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/e/4cMeK/Facesitting%20035-037%20anya%20mara_cover.jpg) (http://pimpandhost.com/image/62150706)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 035-037 anya mara
Runtime : 18min 2s
File Size : 137 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/e/4cMeL/Facesitting%20035-037%20anya%20mara_thumb_0.jpg) (http://pimpandhost.com/image/62150707)

Download Links:

Facesitting 035-037 anya mara.rar (http://k2s.cc/file/00cb3a9bd4421)
Title: Facesitting 038 039 anya
Post by: squidmanheis on February 16, 2017, 11:41:59 pm
Facesitting 038-039 anya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/f/4cMfT/Facesitting%20038-039%20anya_cover.jpg) (http://pimpandhost.com/image/62150777)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 038-039 anya
Runtime : 15min 5s
File Size : 115 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/f/4cMfX/Facesitting%20038-039%20anya_thumb_0.jpg) (http://pimpandhost.com/image/62150781)

Download Links:

Facesitting 038-039 anya.rar (http://k2s.cc/file/b3a5ee2d79031)
Title: Facesitting 040 041 katya yuliya
Post by: squidmanheis on February 17, 2017, 03:06:56 am
Facesitting 040-041 katya yuliya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/h/4cMhj/Facesitting%20040-041%20katya%20yuliya_cover.jpg) (http://pimpandhost.com/image/62150865)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 040-041 katya yuliya
Runtime : 12min 12s
File Size : 92.9 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/h/4cMhl/Facesitting%20040-041%20katya%20yuliya_thumb_0.jpg) (http://pimpandhost.com/image/62150867)

Download Links:

Facesitting 040-041 katya yuliya.rar (http://k2s.cc/file/e8ada07b54d88)
Title: Facesitting 043 044 maya
Post by: squidmanheis on February 17, 2017, 06:32:00 am
Facesitting 043-044 maya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/i/4cMic/Facesitting%20043-044%20maya_cover.jpg) (http://pimpandhost.com/image/62150920)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 043-044 maya
Runtime : 11min 24s
File Size : 86.9 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/i/4cMie/Facesitting%20043-044%20maya_thumb_0.jpg) (http://pimpandhost.com/image/62150922)

Download Links:

Facesitting 043-044 maya.rar (http://k2s.cc/file/f427191ab2491)
Title: Facesitting 054 056 ira tamara
Post by: squidmanheis on February 17, 2017, 09:56:58 am
Facesitting 054-056 ira tamara

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/l/4cMl4/Facesitting%20054-056%20ira%20tamara_cover.jpg) (http://pimpandhost.com/image/62151098)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 054-056 ira tamara
Runtime : 18min 20s
File Size : 137 MB
File Type: wmv
Resolution : 320x240

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/l/4cMl7/Facesitting%20054-056%20ira%20tamara_thumb_0.jpg) (http://pimpandhost.com/image/62151101)

Download Links:

Facesitting 054-056 ira tamara.rar (http://k2s.cc/file/0338d793d1b2a)
Title: Facesitting 057 059 anna mara
Post by: squidmanheis on February 17, 2017, 01:21:57 pm
Facesitting 057-059 anna mara

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/m/4cMmy/Facesitting%20057-059%20anna%20mara_cover.jpg) (http://pimpandhost.com/image/62151190)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 057-059 anna mara
Runtime : 19min 22s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/m/4cMmz/Facesitting%20057-059%20anna%20mara_thumb_0.jpg) (http://pimpandhost.com/image/62151191)

Download Links:

Facesitting 057-059 anna mara.rar (http://k2s.cc/file/bbc658b40e0d8)
Title: Facesitting 060 062 maya lisa
Post by: squidmanheis on February 17, 2017, 04:46:56 pm
Facesitting 060-062 maya lisa

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/n/4cMnV/Facesitting%20060-062%20maya%20lisa_cover.jpg) (http://pimpandhost.com/image/62151275)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 060-062 maya lisa
Runtime : 17min 46s
File Size : 135 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/n/4cMnY/Facesitting%20060-062%20maya%20lisa_thumb_0.jpg) (http://pimpandhost.com/image/62151278)

Download Links:

Facesitting 060-062 maya lisa.rar (http://k2s.cc/file/aa18c015b574a)
Title: Facesitting 063 064 irina maya
Post by: squidmanheis on February 17, 2017, 08:11:53 pm
Facesitting 063-064 irina maya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/p/4cMp1/Facesitting%20063-064%20irina%20maya_cover.jpg) (http://pimpandhost.com/image/62151343)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 063-064 irina maya
Runtime : 15min 23s
File Size : 117 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/p/4cMp2/Facesitting%20063-064%20irina%20maya_thumb_0.jpg) (http://pimpandhost.com/image/62151344)

Download Links:

Facesitting 063-064 irina maya.rar (http://k2s.cc/file/b995ef37a8b74)
Title: Facesitting 065 066 tanya
Post by: squidmanheis on February 17, 2017, 11:36:51 pm
Facesitting 065-066 tanya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/p/4cMpX/Facesitting%20065-066%20tanya_cover.jpg) (http://pimpandhost.com/image/62151401)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 065-066 tanya
Runtime : 14min 39s
File Size : 112 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/q/4cMq3/Facesitting%20065-066%20tanya_thumb_0.jpg) (http://pimpandhost.com/image/62151407)

Download Links:

Facesitting 065-066 tanya.rar (http://k2s.cc/file/337af66d5f79c)
Title: Facesitting 067 068 ira
Post by: squidmanheis on February 18, 2017, 03:01:55 am
Facesitting 067-068 ira

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/r/4cMr8/Facesitting%20067-068%20ira_cover.jpg) (http://pimpandhost.com/image/62151474)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 067-068 ira
Runtime : 12min 45s
File Size : 97.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/r/4cMrd/Facesitting%20067-068%20ira_thumb_0.jpg) (http://pimpandhost.com/image/62151479)

Download Links:

Facesitting 067-068 ira.rar (http://k2s.cc/file/5e57bd9218378)
Title: Facesitting 069 070 yana
Post by: squidmanheis on February 18, 2017, 06:26:57 am
Facesitting 069-070 yana

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/s/4cMsg/Facesitting%20069-070%20yana_cover.jpg) (http://pimpandhost.com/image/62151544)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 069-070 yana
Runtime : 11min 32s
File Size : 87.9 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/s/4cMsm/Facesitting%20069-070%20yana_thumb_0.jpg) (http://pimpandhost.com/image/62151550)

Download Links:

Facesitting 069-070 yana.rar (http://k2s.cc/file/693051ee84540)
Title: Facesitting 071 073 anna mara
Post by: squidmanheis on February 18, 2017, 09:51:54 am
Facesitting 071-073 anna mara

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/t/4cMt9/Facesitting%20071-073%20anna%20mara_cover.jpg) (http://pimpandhost.com/image/62151599)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 071-073 anna mara
Runtime : 22min 12s
File Size : 169 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/t/4cMtd/Facesitting%20071-073%20anna%20mara_thumb_0.jpg) (http://pimpandhost.com/image/62151603)

Download Links:

Facesitting 071-073 anna mara.rar (http://k2s.cc/file/1642947904e9d)
Title: Facesitting 074 076 ira
Post by: squidmanheis on February 18, 2017, 01:16:52 pm
Facesitting 074-076 ira

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/u/4cMuG/Facesitting%20074-076%20ira_cover.jpg) (http://pimpandhost.com/image/62151694)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 074-076 ira
Runtime : 17min 59s
File Size : 138 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/u/4cMuI/Facesitting%20074-076%20ira_thumb_0.jpg) (http://pimpandhost.com/image/62151696)

Download Links:

Facesitting 074-076 ira.rar (http://k2s.cc/file/cbafea296ca8a)
Title: Facesitting 077 079 ksusha galushko
Post by: squidmanheis on February 18, 2017, 04:41:59 pm
Facesitting 077-079 ksusha galushko

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/x/4cMxL/Facesitting%20077-079%20ksusha%20galushko_cover.jpg) (http://pimpandhost.com/image/62151885)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 077-079 ksusha galushko
Runtime : 18min 0s
File Size : 137 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/x/4cMxX/Facesitting%20077-079%20ksusha%20galushko_thumb_0.jpg) (http://pimpandhost.com/image/62151897)

Download Links:

Facesitting 077-079 ksusha galushko.rar (http://k2s.cc/file/8659c60d066f5)
Title: Facesitting 080 081 sveta brusser
Post by: squidmanheis on February 18, 2017, 08:06:51 pm
Facesitting 080-081 sveta brusser

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/z/4cMzr/Facesitting%20080-081%20sveta%20brusser_cover.jpg) (http://pimpandhost.com/image/62151989)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 080-081 sveta brusser
Runtime : 15min 35s
File Size : 119 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/z/4cMzt/Facesitting%20080-081%20sveta%20brusser_thumb_0.jpg) (http://pimpandhost.com/image/62151991)

Download Links:

Facesitting 080-081 sveta brusser.rar (http://k2s.cc/file/9e02fb5a7810f)
Title: Facesitting 085 087 sveta brusser pavlik
Post by: squidmanheis on February 18, 2017, 11:31:57 pm
Facesitting 085-087 sveta brusser pavlik

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/A/4cMAK/Facesitting%20085-087%20sveta%20brusser%20pavlik_cover.jpg) (http://pimpandhost.com/image/62152070)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 085-087 sveta brusser pavlik
Runtime : 18min 8s
File Size : 138 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/A/4cMAM/Facesitting%20085-087%20sveta%20brusser%20pavlik_thumb_0.jpg) (http://pimpandhost.com/image/62152072)

Download Links:

Facesitting 085-087 sveta brusser pavlik.rar (http://k2s.cc/file/f468f2bfbb6eb)
Title: Facesitting 088 089 rita
Post by: squidmanheis on February 19, 2017, 02:56:56 am
Facesitting 088-089 rita

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/C/4cMC2/Facesitting%20088-089%20rita_cover.jpg) (http://pimpandhost.com/image/62152150)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 088-089 rita
Runtime : 14min 30s
File Size : 110 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/C/4cMC6/Facesitting%20088-089%20rita_thumb_0.jpg) (http://pimpandhost.com/image/62152154)

Download Links:

Facesitting 088-089 rita.rar (http://k2s.cc/file/6b8a84617b7cf)
Title: Facesitting 090 091 rita ira
Post by: squidmanheis on February 19, 2017, 06:21:55 am
Facesitting 090-091 rita ira

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/D/4cMDc/Facesitting%20090-091%20rita%20ira_cover.jpg) (http://pimpandhost.com/image/62152222)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 090-091 rita ira
Runtime : 11min 31s
File Size : 88.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/D/4cMDi/Facesitting%20090-091%20rita%20ira_thumb_0.jpg) (http://pimpandhost.com/image/62152228)

Download Links:

Facesitting 090-091 rita ira.rar (http://k2s.cc/file/6ad72ac5989f6)
Title: Facesitting 092 Anna Nabery
Post by: squidmanheis on February 19, 2017, 09:46:56 am
Facesitting 092 Anna Nabery

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/E/4cMEh/Facesitting%20092%20Anna%20Nabery_cover.jpg) (http://pimpandhost.com/image/62152289)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 092 Anna Nabery
Runtime : 9min 47s
File Size : 74.4 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/E/4cMEj/Facesitting%20092%20Anna%20Nabery_thumb_0.jpg) (http://pimpandhost.com/image/62152291)

Download Links:

Facesitting 092 Anna Nabery.rar (http://k2s.cc/file/0f43130264f50)
Title: Facesitting 094 maya
Post by: squidmanheis on February 19, 2017, 01:11:52 pm
Facesitting 094 maya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/E/4cMEW/Facesitting%20094%20maya_cover.jpg) (http://pimpandhost.com/image/62152330)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 094 maya
Runtime : 14min 45s
File Size : 112 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/F/4cMF0/Facesitting%20094%20maya_thumb_0.jpg) (http://pimpandhost.com/image/62152334)

Download Links:

Facesitting 094 maya.rar (http://k2s.cc/file/d4feb05123943)
Title: Facesitting 095 097 sveta brusser
Post by: squidmanheis on February 19, 2017, 04:36:51 pm
Facesitting 095-097 sveta brusser

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/G/4cMGq/Facesitting%20095-097%20sveta%20brusser_cover.jpg) (http://pimpandhost.com/image/62152422)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 095-097 sveta brusser
Runtime : 19min 19s
File Size : 204 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/G/4cMGv/Facesitting%20095-097%20sveta%20brusser_thumb_0.jpg) (http://pimpandhost.com/image/62152427)

Download Links:

Facesitting 095-097 sveta brusser.rar (http://k2s.cc/file/91f816794d8b0)
Title: Facesitting 098 099 ira onyxCL
Post by: squidmanheis on February 19, 2017, 08:01:43 pm
Facesitting 098-099 ira onyxCL

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/J/4cMJi/Facesitting%20098-099%20ira%20onyxCL_cover.jpg) (http://pimpandhost.com/image/62152600)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 098-099 ira onyxCL
Runtime : 11min 51s
File Size : 125 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/J/4cMJl/Facesitting%20098-099%20ira%20onyxCL_thumb_0.jpg) (http://pimpandhost.com/image/62152603)

Download Links:

Facesitting 098-099 ira onyxCL.rar (http://k2s.cc/file/34f4c7131855d)
Title: Facesitting 105 alisa
Post by: squidmanheis on February 19, 2017, 11:26:58 pm
Facesitting 105 alisa

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/K/4cMKA/Facesitting%20105%20alisa_cover.jpg) (http://pimpandhost.com/image/62152680)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 105 alisa
Runtime : 3min 56s
File Size : 39.8 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/K/4cMKB/Facesitting%20105%20alisa_thumb_0.jpg) (http://pimpandhost.com/image/62152681)

Download Links:

Facesitting 105 alisa.rar (http://k2s.cc/file/9e77ffe438aec)
Title: Facesitting 111 112 nata
Post by: squidmanheis on February 20, 2017, 02:51:59 am
Facesitting 111-112 nata

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/L/4cML1/Facesitting%20111-112%20nata_cover.jpg) (http://pimpandhost.com/image/62152707)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 111-112 nata
Runtime : 11min 58s
File Size : 90.4 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/L/4cML7/Facesitting%20111-112%20nata_thumb_0.jpg) (http://pimpandhost.com/image/62152713)

Download Links:

Facesitting 111-112 nata.rar (http://k2s.cc/file/f07c5526e27bf)
Title: Facesitting 113 114 nika
Post by: squidmanheis on February 20, 2017, 06:17:00 am
Facesitting 113-114 nika

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/M/4cMMn/Facesitting%20113-114%20nika_cover.jpg) (http://pimpandhost.com/image/62152791)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 113-114 nika
Runtime : 12min 9s
File Size : 91.8 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/M/4cMMx/Facesitting%20113-114%20nika_thumb_0.jpg) (http://pimpandhost.com/image/62152801)

Download Links:

Facesitting 113-114 nika.rar (http://k2s.cc/file/8b03a4782237e)
Title: Facesitting 116 nika nata
Post by: squidmanheis on February 20, 2017, 09:41:55 am
Facesitting 116 nika nata

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/N/4cMNZ/Facesitting%20116%20nika%20nata_cover.jpg) (http://pimpandhost.com/image/62152891)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 116 nika nata
Runtime : 11min 52s
File Size : 89.7 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/O/4cMO2/Facesitting%20116%20nika%20nata_thumb_0.jpg) (http://pimpandhost.com/image/62152894)

Download Links:

Facesitting 116 nika nata.rar (http://k2s.cc/file/109c40bc97915)
Title: Facesitting 117 119 nata
Post by: squidmanheis on February 20, 2017, 01:06:55 pm
Facesitting 117-119 nata

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/P/4cMP5/Facesitting%20117-119%20nata_cover.jpg) (http://pimpandhost.com/image/62152959)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 117-119 nata
Runtime : 17min 56s
File Size : 135 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/P/4cMP9/Facesitting%20117-119%20nata_thumb_0.jpg) (http://pimpandhost.com/image/62152963)

Download Links:

Facesitting 117-119 nata.rar (http://k2s.cc/file/864a17ad7909f)
Title: Facesitting 120 maya
Post by: squidmanheis on February 20, 2017, 04:31:50 pm
Facesitting 120 maya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/Q/4cMQR/Facesitting%20120%20maya_cover.jpg) (http://pimpandhost.com/image/62153069)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 120 maya
Runtime : 5min 43s
File Size : 43.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/R/4cMR1/Facesitting%20120%20maya_thumb_0.jpg) (http://pimpandhost.com/image/62153079)

Download Links:

Facesitting 120 maya.rar (http://k2s.cc/file/b14b93c58a652)
Title: Facesitting 121 Lera & Yulya
Post by: squidmanheis on February 20, 2017, 07:56:53 pm
Facesitting 121 Lera & Yulya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/T/4cMTa/Facesitting%20121%20Lera%20%26%20Yulya_cover.jpg) (http://pimpandhost.com/image/62153212)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 121 Lera & Yulya
Runtime : 11min 42s
File Size : 88.3 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/T/4cMTc/Facesitting%20121%20Lera%20%26%20Yulya_thumb_0.jpg) (http://pimpandhost.com/image/62153214)

Download Links:

Facesitting 121 Lera & Yulya.rar (http://k2s.cc/file/a64758d768760)
Title: Facesitting 122 maya
Post by: squidmanheis on February 20, 2017, 11:21:51 pm
Facesitting 122 maya

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/U/4cMU8/Facesitting%20122%20maya_cover.jpg) (http://pimpandhost.com/image/62153272)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 122 maya
Runtime : 13min 25s
File Size : 101 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/U/4cMUp/Facesitting%20122%20maya_thumb_0.jpg) (http://pimpandhost.com/image/62153289)

Download Links:

Facesitting 122 maya.rar (http://k2s.cc/file/c3b502b33e7d6)
Title: Facesitting 123 lera pov
Post by: squidmanheis on February 21, 2017, 02:46:50 am
Facesitting 123 lera pov

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/V/4cMVm/Facesitting%20123%20lera%20pov_cover.jpg) (http://pimpandhost.com/image/62153348)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 123 lera pov
Runtime : 6min 37s
File Size : 49.9 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/V/4cMVq/Facesitting%20123%20lera%20pov_thumb_0.jpg) (http://pimpandhost.com/image/62153352)

Download Links:

Facesitting 123 lera pov.rar (http://k2s.cc/file/177779a24b304)
Title: Facesitting 124 ira pov
Post by: squidmanheis on February 21, 2017, 06:11:53 am
Facesitting 124 ira pov

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/V/4cMVT/Facesitting%20124%20ira%20pov_cover.jpg) (http://pimpandhost.com/image/62153381)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 124 ira pov
Runtime : 6min 9s
File Size : 46.4 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/V/4cMVV/Facesitting%20124%20ira%20pov_thumb_0.jpg) (http://pimpandhost.com/image/62153383)

Download Links:

Facesitting 124 ira pov.rar (http://k2s.cc/file/5d447dc7be1a0)
Title: Facesitting 125 126 lera
Post by: squidmanheis on February 21, 2017, 09:36:48 am
Facesitting 125-126 lera

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/W/4cMWp/Facesitting%20125-126%20lera_cover.jpg) (http://pimpandhost.com/image/62153413)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 125-126 lera
Runtime : 12min 40s
File Size : 95.7 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/W/4cMWu/Facesitting%20125-126%20lera_thumb_0.jpg) (http://pimpandhost.com/image/62153418)

Download Links:

Facesitting 125-126 lera.rar (http://k2s.cc/file/eea0d2d3ec49e)
Title: Facesitting 127 128 lera
Post by: squidmanheis on February 21, 2017, 01:01:51 pm
Facesitting 127-128 lera

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/X/4cMX4/Facesitting%20127-128%20lera_cover.jpg) (http://pimpandhost.com/image/62153454)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 127-128 lera
Runtime : 11min 55s
File Size : 90.0 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/X/4cMX5/Facesitting%20127-128%20lera_thumb_0.jpg) (http://pimpandhost.com/image/62153455)

Download Links:

Facesitting 127-128 lera.rar (http://k2s.cc/file/529c4511d9dab)
Title: Facesitting 129 130 irina
Post by: squidmanheis on February 21, 2017, 04:26:45 pm
Facesitting 129-130 irina

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/X/4cMXl/Facesitting%20129-130%20irina_cover.jpg) (http://pimpandhost.com/image/62153471)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 129-130 irina
Runtime : 14min 11s
File Size : 107 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/X/4cMXn/Facesitting%20129-130%20irina_thumb_0.jpg) (http://pimpandhost.com/image/62153473)

Download Links:

Facesitting 129-130 irina.rar (http://k2s.cc/file/4bdbe3c5c3b15)
Title: Facesitting Bitches A New Game
Post by: squidmanheis on February 21, 2017, 07:51:45 pm
Facesitting Bitches - A New Game

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/X/4cMXN/Facesitting%20Bitches%20-%20A%20New%20Game_cover.jpg) (http://pimpandhost.com/image/62153499)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - A New Game
Runtime : 30min 34s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/X/4cMXO/Facesitting%20Bitches%20-%20A%20New%20Game_thumb_0.jpg) (http://pimpandhost.com/image/62153500)

Download Links:

Facesitting Bitches - A New Game.rar (http://k2s.cc/file/c1ba1b61f9f6d)
Title: Facesitting Bitches A Real Man
Post by: squidmanheis on February 21, 2017, 11:16:41 pm
Facesitting Bitches - A Real Man

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/Y/4cMYk/Facesitting%20Bitches%20-%20A%20Real%20Man%20_cover.jpg) (http://pimpandhost.com/image/62153532)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - A Real Man
Runtime : 30min 16s
File Size : 170 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/Y/4cMYm/Facesitting%20Bitches%20-%20A%20Real%20Man%20_thumb_0.jpg) (http://pimpandhost.com/image/62153534)

Download Links:

Facesitting Bitches - A Real Man .rar (http://k2s.cc/file/947cad0e942ee)
Title: Facesitting Bitches A Sitting With Santa
Post by: squidmanheis on February 22, 2017, 02:41:41 am
Facesitting Bitches - A Sitting With Santa

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/Z/4cMZe/Facesitting%20Bitches%20-%20A%20Sitting%20With%20Santa_cover.jpg) (http://pimpandhost.com/image/62153588)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - A Sitting With Santa
Runtime : 28min 6s
File Size : 157 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/M/Z/4cMZh/Facesitting%20Bitches%20-%20A%20Sitting%20With%20Santa_thumb_0.jpg) (http://pimpandhost.com/image/62153591)

Download Links:

Facesitting Bitches - A Sitting With Santa.rar (http://k2s.cc/file/ab7fac58656aa)
Title: Facesitting Bitches A Snug Fit
Post by: squidmanheis on February 22, 2017, 06:06:41 am
Facesitting Bitches - A Snug Fit

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/0/4cN09/Facesitting%20Bitches%20-%20A%20Snug%20Fit_cover.jpg) (http://pimpandhost.com/image/62153645)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - A Snug Fit
Runtime : 30min 22s
File Size : 170 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/0/4cN0e/Facesitting%20Bitches%20-%20A%20Snug%20Fit_thumb_0.jpg) (http://pimpandhost.com/image/62153650)

Download Links:

Facesitting Bitches - A Snug Fit.rar (http://k2s.cc/file/f3918d578baa1)
Title: Facesitting Bitches A Trip to the Shrink
Post by: squidmanheis on February 22, 2017, 09:31:43 am
Facesitting Bitches - A Trip to the Shrink

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/1/4cN12/Facesitting%20Bitches%20-%20A%20Trip%20to%20the%20Shrink_cover.jpg) (http://pimpandhost.com/image/62153700)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - A Trip to the Shrink
Runtime : 29min 41s
File Size : 166 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/1/4cN13/Facesitting%20Bitches%20-%20A%20Trip%20to%20the%20Shrink_thumb_0.jpg) (http://pimpandhost.com/image/62153701)

Download Links:

Facesitting Bitches - A Trip to the Shrink.rar (http://k2s.cc/file/f927e6c567be3)
Title: Facesitting Bitches An Introduction To Facesitting
Post by: squidmanheis on February 22, 2017, 12:56:57 pm
Facesitting Bitches - An Introduction To Facesitting

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/1/4cN1G/Facesitting%20Bitches%20-%20An%20Introduction%20To%20Facesitting_cover.jpg) (http://pimpandhost.com/image/62153740)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - An Introduction To Facesitting
Runtime : 28min 55s
File Size : 162 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/1/4cN1I/Facesitting%20Bitches%20-%20An%20Introduction%20To%20Facesitting_thumb_0.jpg) (http://pimpandhost.com/image/62153742)

Download Links:

Facesitting Bitches - An Introduction To Facesitting.rar (http://k2s.cc/file/0cad173c4b20a)
Title: Facesitting Bitches Anyone For Tennis
Post by: squidmanheis on February 22, 2017, 04:21:37 pm
Facesitting Bitches - Anyone For Tennis

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/2/4cN2m/Facesitting%20Bitches%20-%20Anyone%20For%20Tennis_cover.jpg) (http://pimpandhost.com/image/62153782)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Anyone For Tennis
Runtime : 29min 56s
File Size : 168 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/2/4cN2p/Facesitting%20Bitches%20-%20Anyone%20For%20Tennis_thumb_0.jpg) (http://pimpandhost.com/image/62153785)

Download Links:

Facesitting Bitches - Anyone For Tennis.rar (http://k2s.cc/file/0620fc7496cf9)
Title: Facesitting Bitches As Seen On TV
Post by: squidmanheis on February 22, 2017, 07:46:37 pm
Facesitting Bitches - As Seen On TV

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/3/4cN32/Facesitting%20Bitches%20-%20As%20Seen%20On%20TV_cover.jpg) (http://pimpandhost.com/image/62153824)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - As Seen On TV
Runtime : 30min 27s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/3/4cN37/Facesitting%20Bitches%20-%20As%20Seen%20On%20TV_thumb_0.jpg) (http://pimpandhost.com/image/62153829)

Download Links:

Facesitting Bitches - As Seen On TV.rar (http://k2s.cc/file/b5e192678550a)
Title: Facesitting Bitches Beckys Bottom
Post by: squidmanheis on February 22, 2017, 11:11:38 pm
Facesitting Bitches - Beckys Bottom

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/5/4cN5s/Facesitting%20Bitches%20-%20Beckys%20Bottom_cover.jpg) (http://pimpandhost.com/image/62153974)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Beckys Bottom
Runtime : 31min 11s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/5/4cN5v/Facesitting%20Bitches%20-%20Beckys%20Bottom_thumb_0.jpg) (http://pimpandhost.com/image/62153977)

Download Links:

Facesitting Bitches - Beckys Bottom.rar (http://k2s.cc/file/fa540af284979)
Title: Facesitting Bitches Belles Booty
Post by: squidmanheis on February 23, 2017, 02:36:37 am
Facesitting Bitches - Belles Booty

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/6/4cN6c/Facesitting%20Bitches%20-%20Belles%20Booty_cover.jpg) (http://pimpandhost.com/image/62154020)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Belles Booty
Runtime : 31min 8s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/6/4cN6e/Facesitting%20Bitches%20-%20Belles%20Booty_thumb_0.jpg) (http://pimpandhost.com/image/62154022)

Download Links:

Facesitting Bitches - Belles Booty.rar (http://k2s.cc/file/2e91f408dc244)
Title: Facesitting Bitches Bum Shots
Post by: squidmanheis on February 23, 2017, 06:01:36 am
Facesitting Bitches - Bum Shots

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/a/4cNam/Facesitting%20Bitches%20-%20Bum%20Shots_cover.jpg) (http://pimpandhost.com/image/62154278)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Bum Shots
Runtime : 30min 4s
File Size : 168 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/a/4cNaq/Facesitting%20Bitches%20-%20Bum%20Shots_thumb_0.jpg) (http://pimpandhost.com/image/62154282)

Download Links:

Facesitting Bitches - Bum Shots.rar (http://k2s.cc/file/f63041202c074)
Title: Facesitting Bitches Caught in the Act
Post by: squidmanheis on February 23, 2017, 09:26:37 am
Facesitting Bitches - Caught in the Act

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/c/4cNcR/Facesitting%20Bitches%20-%20Caught%20in%20the%20Act_cover.jpg) (http://pimpandhost.com/image/62154433)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Caught in the Act
Runtime : 31min 4s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/c/4cNcW/Facesitting%20Bitches%20-%20Caught%20in%20the%20Act_thumb_0.jpg) (http://pimpandhost.com/image/62154438)

Download Links:

Facesitting Bitches - Caught in the Act.rar (http://k2s.cc/file/fe3b9312b05fe)
Title: Facesitting Bitches Cheerleader Crush
Post by: squidmanheis on February 23, 2017, 12:51:35 pm
Facesitting Bitches - Cheerleader Crush

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/f/4cNfr/Facesitting%20Bitches%20-%20Cheerleader%20Crush_cover.jpg) (http://pimpandhost.com/image/62154593)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Cheerleader Crush
Runtime : 31min 1s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/f/4cNfz/Facesitting%20Bitches%20-%20Cheerleader%20Crush_thumb_0.jpg) (http://pimpandhost.com/image/62154601)

Download Links:

Facesitting Bitches - Cheerleader Crush.rar (http://k2s.cc/file/d2291fdcf57ed)
Title: Facesitting Bitches Cleaned Out
Post by: squidmanheis on February 23, 2017, 04:16:38 pm
Facesitting Bitches - Cleaned Out

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/i/4cNiS/Facesitting%20Bitches%20-%20Cleaned%20Out_cover.jpg) (http://pimpandhost.com/image/62154806)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Cleaned Out
Runtime : 30min 45s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/i/4cNiZ/Facesitting%20Bitches%20-%20Cleaned%20Out_thumb_0.jpg) (http://pimpandhost.com/image/62154813)

Download Links:

Facesitting Bitches - Cleaned Out.rar (http://k2s.cc/file/0c214cce5f490)
Title: Facesitting Bitches Clifftop Crush
Post by: squidmanheis on February 23, 2017, 07:41:56 pm
Facesitting Bitches - Clifftop Crush

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/k/4cNkT/Facesitting%20Bitches%20-%20Clifftop%20Crush_cover.jpg) (http://pimpandhost.com/image/62154931)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Clifftop Crush
Runtime : 29min 30s
File Size : 165 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/k/4cNkY/Facesitting%20Bitches%20-%20Clifftop%20Crush_thumb_0.jpg) (http://pimpandhost.com/image/62154936)

Download Links:

Facesitting Bitches - Clifftop Crush.rar (http://k2s.cc/file/63440ec93fb2f)
Title: Facesitting Bitches Coffee Table Reading
Post by: squidmanheis on February 23, 2017, 11:06:44 pm
Facesitting Bitches - Coffee Table Reading

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/m/4cNmP/Facesitting%20Bitches%20-%20Coffee%20Table%20Reading_cover.jpg) (http://pimpandhost.com/image/62155051)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Coffee Table Reading
Runtime : 29min 39s
File Size : 166 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/m/4cNmV/Facesitting%20Bitches%20-%20Coffee%20Table%20Reading_thumb_0.jpg) (http://pimpandhost.com/image/62155057)

Download Links:

Facesitting Bitches - Coffee Table Reading.rar (http://k2s.cc/file/50f3feb5617c0)
Title: Facesitting Bitches Dirty Old Man
Post by: squidmanheis on February 24, 2017, 02:31:34 am
Facesitting Bitches - Dirty Old Man

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/o/4cNoZ/Facesitting%20Bitches%20-%20Dirty%20Old%20Man_cover.jpg) (http://pimpandhost.com/image/62155185)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Dirty Old Man
Runtime : 31min 5s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/p/4cNp2/Facesitting%20Bitches%20-%20Dirty%20Old%20Man_thumb_0.jpg) (http://pimpandhost.com/image/62155188)

Download Links:

Facesitting Bitches - Dirty Old Man.rar (http://k2s.cc/file/53717b92b091b)
Title: Facesitting Bitches Diving Practice
Post by: squidmanheis on February 24, 2017, 05:56:33 am
Facesitting Bitches - Diving Practice

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/r/4cNro/Facesitting%20Bitches%20-%20Diving%20Practice_cover.jpg) (http://pimpandhost.com/image/62155334)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Diving Practice
Runtime : 29min 43s
File Size : 166 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/r/4cNrt/Facesitting%20Bitches%20-%20Diving%20Practice_thumb_0.jpg) (http://pimpandhost.com/image/62155339)

Download Links:

Facesitting Bitches - Diving Practice.rar (http://k2s.cc/file/c1373ef807310)
Title: Facesitting Bitches Does My Bum Look Big In This
Post by: squidmanheis on February 24, 2017, 09:21:35 am
Facesitting Bitches - Does My Bum Look Big In This

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/t/4cNtt/Facesitting%20Bitches%20-%20Does%20My%20Bum%20Look%20Big%20In%20This_cover.jpg) (http://pimpandhost.com/image/62155463)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Does My Bum Look Big In This
Runtime : 30min 34s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/t/4cNtx/Facesitting%20Bitches%20-%20Does%20My%20Bum%20Look%20Big%20In%20This_thumb_0.jpg) (http://pimpandhost.com/image/62155467)

Download Links:

Facesitting Bitches - Does My Bum Look Big In This.rar (http://k2s.cc/file/bb0ad4960691b)
Title: Facesitting Bitches Dungeon Double
Post by: squidmanheis on February 24, 2017, 12:46:38 pm
Facesitting Bitches - Dungeon Double

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/x/4cNx1/Facesitting%20Bitches%20-%20Dungeon%20Double_cover.jpg) (http://pimpandhost.com/image/62155683)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Dungeon Double
Runtime : 31min 11s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/x/4cNxe/Facesitting%20Bitches%20-%20Dungeon%20Double_thumb_0.jpg) (http://pimpandhost.com/image/62155696)

Download Links:

Facesitting Bitches - Dungeon Double.rar (http://k2s.cc/file/ff6fd4850c0d7)
Title: Facesitting Bitches Enough For Two
Post by: squidmanheis on February 24, 2017, 04:11:31 pm
Facesitting Bitches - Enough For Two

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/z/4cNzg/Facesitting%20Bitches%20-%20Enough%20For%20Two_cover.jpg) (http://pimpandhost.com/image/62155822)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Enough For Two
Runtime : 30min 16s
File Size : 170 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/z/4cNzj/Facesitting%20Bitches%20-%20Enough%20For%20Two_thumb_0.jpg) (http://pimpandhost.com/image/62155825)

Download Links:

Facesitting Bitches - Enough For Two.rar (http://k2s.cc/file/e0896a458bc15)
Title: Facesitting Bitches Essex Tart
Post by: squidmanheis on February 24, 2017, 07:36:38 pm
Facesitting Bitches - Essex Tart

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/B/4cNB4/Facesitting%20Bitches%20-%20Essex%20Tart_cover.jpg) (http://pimpandhost.com/image/62155934)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Essex Tart
Runtime : 31min 10s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/B/4cNB5/Facesitting%20Bitches%20-%20Essex%20Tart_thumb_0.jpg) (http://pimpandhost.com/image/62155935)

Download Links:

Facesitting Bitches - Essex Tart.rar (http://k2s.cc/file/8d0886f287557)
Title: Facesitting Bitches Extra Tuition
Post by: squidmanheis on February 24, 2017, 11:01:29 pm
Facesitting Bitches - Extra Tuition

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/B/4cNBC/Facesitting%20Bitches%20-%20Extra%20Tuition_cover.jpg) (http://pimpandhost.com/image/62155968)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Extra Tuition
Runtime : 30min 7s
File Size : 169 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/B/4cNBD/Facesitting%20Bitches%20-%20Extra%20Tuition_thumb_0.jpg) (http://pimpandhost.com/image/62155969)

Download Links:

Facesitting Bitches - Extra Tuition.rar (http://k2s.cc/file/46eb0ae6a594a)
Title: Facesitting Bitches Face Dance
Post by: squidmanheis on February 25, 2017, 02:26:27 am
Facesitting Bitches - Face Dance

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/C/4cNC9/Facesitting%20Bitches%20-%20Face%20Dance_cover.jpg) (http://pimpandhost.com/image/62156001)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Face Dance
Runtime : 30min 13s
File Size : 169 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/C/4cNCc/Facesitting%20Bitches%20-%20Face%20Dance_thumb_0.jpg) (http://pimpandhost.com/image/62156004)

Download Links:

Facesitting Bitches - Face Dance.rar (http://k2s.cc/file/b57482b6d25b7)
Title: Facesitting Bitches Forced To Watch
Post by: squidmanheis on February 25, 2017, 05:51:43 am
Facesitting Bitches - Forced To Watch

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/C/4cNCE/Facesitting%20Bitches%20-%20Forced%20To%20Watch_cover.jpg) (http://pimpandhost.com/image/62156032)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Forced To Watch
Runtime : 31min 3s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/C/4cNCG/Facesitting%20Bitches%20-%20Forced%20To%20Watch_thumb_0.jpg) (http://pimpandhost.com/image/62156034)

Download Links:

Facesitting Bitches - Forced To Watch.rar (http://k2s.cc/file/9c0b7699f27a2)
Title: Facesitting Bitches Found Out
Post by: squidmanheis on February 25, 2017, 09:16:23 am
Facesitting Bitches - Found Out

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/D/4cNDv/Facesitting%20Bitches%20-%20Found%20Out_cover.jpg) (http://pimpandhost.com/image/62156085)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Found Out
Runtime : 31min 0s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/D/4cNDx/Facesitting%20Bitches%20-%20Found%20Out_thumb_0.jpg) (http://pimpandhost.com/image/62156087)

Download Links:

Facesitting Bitches - Found Out.rar (http://k2s.cc/file/b5b5ad79dfb5e)
Title: Facesitting Bitches French Maid Fury
Post by: squidmanheis on February 25, 2017, 12:41:16 pm
Facesitting Bitches - French Maid Fury

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/F/4cNFm/Facesitting%20Bitches%20-%20French%20Maid%20Fury_cover.jpg) (http://pimpandhost.com/image/62156200)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - French Maid Fury
Runtime : 28min 36s
File Size : 160 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/F/4cNFo/Facesitting%20Bitches%20-%20French%20Maid%20Fury_thumb_0.jpg) (http://pimpandhost.com/image/62156202)

Download Links:

Facesitting Bitches - French Maid Fury.rar (http://k2s.cc/file/cd66b4ccf79b5)
Title: Facesitting Bitches Fresh Knickers
Post by: squidmanheis on February 25, 2017, 04:06:22 pm
Facesitting Bitches - Fresh Knickers

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/G/4cNGq/Facesitting%20Bitches%20-%20Fresh%20Knickers_cover.jpg) (http://pimpandhost.com/image/62156266)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Fresh Knickers
Runtime : 30min 12s
File Size : 169 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/G/4cNGr/Facesitting%20Bitches%20-%20Fresh%20Knickers_thumb_0.jpg) (http://pimpandhost.com/image/62156267)

Download Links:

Facesitting Bitches - Fresh Knickers.rar (http://k2s.cc/file/fcee6cc09abd2)
Title: Facesitting Bitches Give me a Rematch
Post by: squidmanheis on February 25, 2017, 07:31:20 pm
Facesitting Bitches - Give me a Rematch

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/H/4cNHo/Facesitting%20Bitches%20-%20Give%20me%20a%20Rematch_cover.jpg) (http://pimpandhost.com/image/62156326)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Give me a Rematch
Runtime : 29min 34s
File Size : 166 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/H/4cNHp/Facesitting%20Bitches%20-%20Give%20me%20a%20Rematch_thumb_0.jpg) (http://pimpandhost.com/image/62156327)

Download Links:

Facesitting Bitches - Give me a Rematch.rar (http://k2s.cc/file/7654fc0dddfd9)
Title: Facesitting Bitches Give me an A Grade
Post by: squidmanheis on February 25, 2017, 10:56:23 pm
Facesitting Bitches - Give me an A Grade

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/J/4cNJx/Facesitting%20Bitches%20-%20Give%20me%20an%20A%20Grade_cover.jpg) (http://pimpandhost.com/image/62156459)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Give me an A Grade
Runtime : 28min 51s
File Size : 162 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/J/4cNJz/Facesitting%20Bitches%20-%20Give%20me%20an%20A%20Grade_thumb_0.jpg) (http://pimpandhost.com/image/62156461)

Download Links:

Facesitting Bitches - Give me an A Grade.rar (http://k2s.cc/file/5b16d8f95388e)
Title: Facesitting Bitches Goldies Mattress Emporium
Post by: squidmanheis on February 26, 2017, 02:21:24 am
Facesitting Bitches - Goldies Mattress Emporium

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/K/4cNKZ/Facesitting%20Bitches%20-%20Goldies%20Mattress%20Emporium_cover.jpg) (http://pimpandhost.com/image/62156549)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Goldies Mattress Emporium
Runtime : 27min 44s
File Size : 155 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/L/4cNL0/Facesitting%20Bitches%20-%20Goldies%20Mattress%20Emporium_thumb_0.jpg) (http://pimpandhost.com/image/62156550)

Download Links:

Facesitting Bitches - Goldies Mattress Emporium.rar (http://k2s.cc/file/b30d93142cd1c)
Title: Facesitting Bitches Gym Sit
Post by: squidmanheis on February 26, 2017, 05:46:23 am
Facesitting Bitches - Gym Sit

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/M/4cNMo/Facesitting%20Bitches%20-%20Gym%20Sit_cover.jpg) (http://pimpandhost.com/image/62156636)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Gym Sit
Runtime : 30min 43s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/M/4cNMp/Facesitting%20Bitches%20-%20Gym%20Sit_thumb_0.jpg) (http://pimpandhost.com/image/62156637)

Download Links:

Facesitting Bitches - Gym Sit.rar (http://k2s.cc/file/8c522c824e455)
Title: Facesitting Bitches Hair Today Gone Tomorrow
Post by: squidmanheis on February 26, 2017, 09:12:19 am
Facesitting Bitches - Hair Today Gone Tomorrow

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/N/4cNNp/Facesitting%20Bitches%20-%20Hair%20Today%20Gone%20Tomorrow_cover.jpg) (http://pimpandhost.com/image/62156699)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Hair Today Gone Tomorrow
Runtime : 30min 31s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/N/4cNNs/Facesitting%20Bitches%20-%20Hair%20Today%20Gone%20Tomorrow_thumb_0.jpg) (http://pimpandhost.com/image/62156702)

Download Links:

Facesitting Bitches - Hair Today Gone Tomorrow.rar (http://k2s.cc/file/7b84898a6fcde)
Title: Facesitting Bitches Hangover from Hell
Post by: squidmanheis on February 26, 2017, 12:37:21 pm
Facesitting Bitches - Hangover from Hell

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/O/4cNOz/Facesitting%20Bitches%20-%20Hangover%20from%20Hell_cover.jpg) (http://pimpandhost.com/image/62156771)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Hangover from Hell
Runtime : 30min 13s
File Size : 169 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/O/4cNOA/Facesitting%20Bitches%20-%20Hangover%20from%20Hell_thumb_0.jpg) (http://pimpandhost.com/image/62156772)

Download Links:

Facesitting Bitches - Hangover from Hell.rar (http://k2s.cc/file/df74caab6b8f8)
Title: Facesitting Bitches Happy Birthday
Post by: squidmanheis on February 26, 2017, 04:02:18 pm
Facesitting Bitches - Happy Birthday

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/P/4cNPv/Facesitting%20Bitches%20-%20Happy%20Birthday_cover.jpg) (http://pimpandhost.com/image/62156829)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Happy Birthday
Runtime : 29min 32s
File Size : 165 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/P/4cNPw/Facesitting%20Bitches%20-%20Happy%20Birthday_thumb_0.jpg) (http://pimpandhost.com/image/62156830)

Download Links:

Facesitting Bitches - Happy Birthday.rar (http://k2s.cc/file/8240aad11ba72)
Title: Facesitting Bitches Have a Good Sniff
Post by: squidmanheis on February 26, 2017, 07:27:17 pm
Facesitting Bitches - Have a Good Sniff

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/Q/4cNQ8/Facesitting%20Bitches%20-%20Have%20a%20Good%20Sniff_cover.jpg) (http://pimpandhost.com/image/62156868)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Have a Good Sniff
Runtime : 29min 19s
File Size : 164 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/Q/4cNQa/Facesitting%20Bitches%20-%20Have%20a%20Good%20Sniff_thumb_0.jpg) (http://pimpandhost.com/image/62156870)

Download Links:

Facesitting Bitches - Have a Good Sniff.rar (http://k2s.cc/file/b2f972b13ebd4)
Title: Facesitting Bitches Housewife Horror
Post by: squidmanheis on February 26, 2017, 10:52:17 pm
Facesitting Bitches - Housewife Horror

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/Q/4cNQC/Facesitting%20Bitches%20-%20Housewife%20Horror_cover.jpg) (http://pimpandhost.com/image/62156898)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Housewife Horror
Runtime : 27min 49s
File Size : 156 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/Q/4cNQK/Facesitting%20Bitches%20-%20Housewife%20Horror_thumb_0.jpg) (http://pimpandhost.com/image/62156906)

Download Links:

Facesitting Bitches - Housewife Horror.rar (http://k2s.cc/file/3da86c05db83f)
Title: Facesitting Bitches How Dare You
Post by: squidmanheis on February 27, 2017, 02:17:06 am
Facesitting Bitches - How Dare You

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/R/4cNR5/Facesitting%20Bitches%20-%20How%20Dare%20You_cover.jpg) (http://pimpandhost.com/image/62156927)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - How Dare You
Runtime : 29min 35s
File Size : 166 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/R/4cNR6/Facesitting%20Bitches%20-%20How%20Dare%20You_thumb_0.jpg) (http://pimpandhost.com/image/62156928)

Download Links:

Facesitting Bitches - How Dare You.rar (http://k2s.cc/file/516b2bcf87bbd)
Title: Facesitting Bitches Human Furniture
Post by: squidmanheis on February 27, 2017, 05:42:06 am
Facesitting Bitches - Human Furniture

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/T/4cNTM/Facesitting%20Bitches%20-%20Human%20Furniture_cover.jpg) (http://pimpandhost.com/image/62157094)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Human Furniture
Runtime : 29min 39s
File Size : 166 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/T/4cNTO/Facesitting%20Bitches%20-%20Human%20Furniture_thumb_0.jpg) (http://pimpandhost.com/image/62157096)

Download Links:

Facesitting Bitches - Human Furniture.rar (http://k2s.cc/file/f5973f9424f7e)
Title: Facesitting Bitches I Like It Weak
Post by: squidmanheis on February 27, 2017, 09:07:04 am
Facesitting Bitches - I Like It Weak

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/U/4cNUv/Facesitting%20Bitches%20-%20I%20Like%20It%20Weak_cover.jpg) (http://pimpandhost.com/image/62157139)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - I Like It Weak
Runtime : 31min 3s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/U/4cNUw/Facesitting%20Bitches%20-%20I%20Like%20It%20Weak_thumb_0.jpg) (http://pimpandhost.com/image/62157140)

Download Links:

Facesitting Bitches - I Like It Weak.rar (http://k2s.cc/file/9e5ed9886d049)
Title: Facesitting Bitches Kinky Keira
Post by: squidmanheis on February 27, 2017, 12:32:04 pm
Facesitting Bitches - Kinky Keira

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/V/4cNV6/Facesitting%20Bitches%20-%20Kinky%20Keira_cover.jpg) (http://pimpandhost.com/image/62157176)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Kinky Keira
Runtime : 30min 51s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/V/4cNV7/Facesitting%20Bitches%20-%20Kinky%20Keira_thumb_0.jpg) (http://pimpandhost.com/image/62157177)

Download Links:

Facesitting Bitches - Kinky Keira.rar (http://k2s.cc/file/e0b74580cc5fa)
Title: Facesitting Bitches Lady of the Manor
Post by: squidmanheis on February 27, 2017, 03:57:04 pm
Facesitting Bitches - Lady of the Manor

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/V/4cNVR/Facesitting%20Bitches%20-%20Lady%20of%20the%20Manor_cover.jpg) (http://pimpandhost.com/image/62157223)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Lady of the Manor
Runtime : 30min 0s
File Size : 168 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/V/4cNVS/Facesitting%20Bitches%20-%20Lady%20of%20the%20Manor_thumb_0.jpg) (http://pimpandhost.com/image/62157224)

Download Links:

Facesitting Bitches - Lady of the Manor.rar (http://k2s.cc/file/34a925c34aa31)
Title: Facesitting Bitches Landlords Loss
Post by: squidmanheis on February 27, 2017, 07:22:17 pm
Facesitting Bitches - Landlords Loss

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/W/4cNWj/Facesitting%20Bitches%20-%20Landlords%20Loss_cover.jpg) (http://pimpandhost.com/image/62157251)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Landlords Loss
Runtime : 30min 2s
File Size : 168 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/W/4cNWk/Facesitting%20Bitches%20-%20Landlords%20Loss_thumb_0.jpg) (http://pimpandhost.com/image/62157252)

Download Links:

Facesitting Bitches - Landlords Loss.rar (http://k2s.cc/file/068ce3e378730)
Title: Facesitting Bitches Lap Dance Disaster
Post by: squidmanheis on February 27, 2017, 10:46:52 pm
Facesitting Bitches - Lap Dance Disaster

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/W/4cNWQ/Facesitting%20Bitches%20-%20Lap%20Dance%20Disaster_cover.jpg) (http://pimpandhost.com/image/62157284)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Lap Dance Disaster
Runtime : 30min 1s
File Size : 168 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/W/4cNWV/Facesitting%20Bitches%20-%20Lap%20Dance%20Disaster_thumb_0.jpg) (http://pimpandhost.com/image/62157289)

Download Links:

Facesitting Bitches - Lap Dance Disaster.rar (http://k2s.cc/file/794cc267de5b3)
Title: Facesitting Bitches Lonely Ass Column
Post by: squidmanheis on February 28, 2017, 02:12:00 am
Facesitting Bitches - Lonely Ass Column

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/X/4cNXm/Facesitting%20Bitches%20-%20Lonely%20Ass%20Column_cover.jpg) (http://pimpandhost.com/image/62157316)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Lonely Ass Columin
Runtime : 29min 32s
File Size : 165 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/X/4cNXn/Facesitting%20Bitches%20-%20Lonely%20Ass%20Column_thumb_0.jpg) (http://pimpandhost.com/image/62157317)

Download Links:

Facesitting Bitches - Lonely Ass Column.rar (http://k2s.cc/file/d47e53184b12d)
Title: Facesitting Bitches Lucys Lodger
Post by: squidmanheis on February 28, 2017, 05:37:02 am
Facesitting Bitches - Lucys Lodger

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/X/4cNXS/Facesitting%20Bitches%20-%20Lucys%20Lodger_cover.jpg) (http://pimpandhost.com/image/62157348)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Lucys Lodger
Runtime : 30min 59s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/X/4cNXT/Facesitting%20Bitches%20-%20Lucys%20Lodger_thumb_0.jpg) (http://pimpandhost.com/image/62157349)

Download Links:

Facesitting Bitches - Lucys Lodger.rar (http://k2s.cc/file/f396fcceca784)
Title: Facesitting Bitches Medicinal Purposes
Post by: squidmanheis on February 28, 2017, 09:01:57 am
Facesitting Bitches - Medicinal Purposes

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/Y/4cNYV/Facesitting%20Bitches%20-%20Medicinal%20Purposes_cover.jpg) (http://pimpandhost.com/image/62157413)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Medicinal Purposes
Runtime : 29min 49s
File Size : 167 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/Y/4cNYX/Facesitting%20Bitches%20-%20Medicinal%20Purposes_thumb_0.jpg) (http://pimpandhost.com/image/62157415)

Download Links:

Facesitting Bitches - Medicinal Purposes.rar (http://k2s.cc/file/f58f573059efe)
Title: Facesitting Bitches Miss Naughty
Post by: squidmanheis on February 28, 2017, 12:27:13 pm
Facesitting Bitches - Miss Naughty

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/Z/4cNZg/Facesitting%20Bitches%20-%20Miss%20Naughty_cover.jpg) (http://pimpandhost.com/image/62157434)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Miss Naughty
Runtime : 30min 39s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/Z/4cNZi/Facesitting%20Bitches%20-%20Miss%20Naughty_thumb_0.jpg) (http://pimpandhost.com/image/62157436)

Download Links:

Facesitting Bitches - Miss Naughty.rar (http://k2s.cc/file/48becf3724091)
Title: Facesitting Bitches Mrs Mistress
Post by: squidmanheis on February 28, 2017, 03:51:55 pm
Facesitting Bitches - Mrs  Mistress

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/Z/4cNZI/Facesitting%20Bitches%20-%20Mrs.%20Mistress_cover.jpg) (http://pimpandhost.com/image/62157462)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Mrs. Mistress
Runtime : 30min 38s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/N/Z/4cNZK/Facesitting%20Bitches%20-%20Mrs.%20Mistress_thumb_0.jpg) (http://pimpandhost.com/image/62157464)

Download Links:

Facesitting Bitches - Mrs. Mistress.rar (http://k2s.cc/file/d51065e246949)
Title: Facesitting Bitches My Ass Is Best
Post by: squidmanheis on February 28, 2017, 07:16:55 pm
Facesitting Bitches - My Ass Is Best

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/0/4cO0d/Facesitting%20Bitches%20-%20My%20Ass%20Is%20Best_cover.jpg) (http://pimpandhost.com/image/62157493)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - My Ass Is Best
Runtime : 30min 37s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/0/4cO0e/Facesitting%20Bitches%20-%20My%20Ass%20Is%20Best_thumb_0.jpg) (http://pimpandhost.com/image/62157494)

Download Links:

Facesitting Bitches - My Ass Is Best.rar (http://k2s.cc/file/79c09314abcfa)
Title: Facesitting Bitches My Kind Of Fun
Post by: squidmanheis on February 28, 2017, 10:41:58 pm
Facesitting Bitches - My Kind Of Fun

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/0/4cO0D/Facesitting%20Bitches%20-%20My%20Kind%20Of%20Fun_cover.jpg) (http://pimpandhost.com/image/62157519)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - My Kind Of Fun
Runtime : 31min 7s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/0/4cO0E/Facesitting%20Bitches%20-%20My%20Kind%20Of%20Fun_thumb_0.jpg) (http://pimpandhost.com/image/62157520)

Download Links:

Facesitting Bitches - My Kind Of Fun.rar (http://k2s.cc/file/7bb69a8acfc8a)
Title: Facesitting Bitches Neighbourhood Watch
Post by: squidmanheis on March 01, 2017, 02:06:56 am
Facesitting Bitches - Neighbourhood Watch

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/1/4cO14/Facesitting%20Bitches%20-%20Neighbourhood%20Watch_cover.jpg) (http://pimpandhost.com/image/62157546)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Neighbourhood Watch
Runtime : 30min 33s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/1/4cO16/Facesitting%20Bitches%20-%20Neighbourhood%20Watch_thumb_0.jpg) (http://pimpandhost.com/image/62157548)

Download Links:

Facesitting Bitches - Neighbourhood Watch.rar (http://k2s.cc/file/3970dac11158f)
Title: Facesitting Bitches Not Tonight
Post by: squidmanheis on March 01, 2017, 05:31:58 am
Facesitting Bitches - Not Tonight

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/1/4cO1w/Facesitting%20Bitches%20-%20Not%20Tonight_cover.jpg) (http://pimpandhost.com/image/62157574)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Not Tonight
Runtime : 30min 41s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/1/4cO1x/Facesitting%20Bitches%20-%20Not%20Tonight_thumb_0.jpg) (http://pimpandhost.com/image/62157575)

Download Links:

Facesitting Bitches - Not Tonight.rar (http://k2s.cc/file/e3341f5aed1eb)
Title: Facesitting Bitches Nudey Mags
Post by: squidmanheis on March 01, 2017, 08:56:54 am
Facesitting Bitches - Nudey Mags

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/1/4cO1V/Facesitting%20Bitches%20-%20Nudey%20Mags_cover.jpg) (http://pimpandhost.com/image/62157599)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Nudey Mags
Runtime : 31min 11s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/1/4cO1X/Facesitting%20Bitches%20-%20Nudey%20Mags_thumb_0.jpg) (http://pimpandhost.com/image/62157601)

Download Links:

Facesitting Bitches - Nudey Mags.rar (http://k2s.cc/file/094231c02d3aa)
Title: Facesitting Bitches Nurse Najas Orders
Post by: squidmanheis on March 01, 2017, 12:21:51 pm
Facesitting Bitches - Nurse Najas Orders

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/2/4cO2v/Facesitting%20Bitches%20-%20Nurse%20Najas%20Orders_cover.jpg) (http://pimpandhost.com/image/62157635)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Nurse Najas Orders
Runtime : 30min 56s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/2/4cO2y/Facesitting%20Bitches%20-%20Nurse%20Najas%20Orders_thumb_0.jpg) (http://pimpandhost.com/image/62157638)

Download Links:

Facesitting Bitches - Nurse Najas Orders.rar (http://k2s.cc/file/315eaf0bf4193)
Title: Facesitting Bitches Office Furniture
Post by: squidmanheis on March 01, 2017, 03:47:06 pm
Facesitting Bitches - Office Furniture

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/3/4cO39/Facesitting%20Bitches%20-%20Office%20Furniture_cover.jpg) (http://pimpandhost.com/image/62157675)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Office Furniture
Runtime : 29min 26s
File Size : 165 MB
File Type: wmv
Resolution : 720x576


Download Links:

Facesitting Bitches - Office Furniture.rar (http://k2s.cc/file/f1a08c124dbcd)
Title: Facesitting Bitches On Your Knees
Post by: squidmanheis on March 01, 2017, 07:11:51 pm
Facesitting Bitches - On Your Knees

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/3/4cO3I/Facesitting%20Bitches%20-%20On%20Your%20Knees_cover.jpg) (http://pimpandhost.com/image/62157710)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - On Your Knees
Runtime : 31min 2s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/3/4cO3M/Facesitting%20Bitches%20-%20On%20Your%20Knees_thumb_0.jpg) (http://pimpandhost.com/image/62157714)

Download Links:

Facesitting Bitches - On Your Knees.rar (http://k2s.cc/file/229c668a6fd6f)
Title: Facesitting Bitches Panty Sniffers Punishment
Post by: squidmanheis on March 01, 2017, 10:36:49 pm
Facesitting Bitches - Panty Sniffers Punishment

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/4/4cO4z/Facesitting%20Bitches%20-%20Panty%20Sniffers%20Punishment_cover.jpg) (http://pimpandhost.com/image/62157763)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Panty Sniffers Punishment
Runtime : 28min 34s
File Size : 160 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/4/4cO4A/Facesitting%20Bitches%20-%20Panty%20Sniffers%20Punishment_thumb_0.jpg) (http://pimpandhost.com/image/62157764)

Download Links:

Facesitting Bitches - Panty Sniffers Punishment.rar (http://k2s.cc/file/60481270526aa)
Title: Facesitting Bitches Payback
Post by: squidmanheis on March 02, 2017, 02:01:48 am
Facesitting Bitches - Payback

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/5/4cO5z/Facesitting%20Bitches%20-%20Payback_cover.jpg) (http://pimpandhost.com/image/62157825)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Payback
Runtime : 30min 39s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/5/4cO5A/Facesitting%20Bitches%20-%20Payback_thumb_0.jpg) (http://pimpandhost.com/image/62157826)

Download Links:

Facesitting Bitches - Payback.rar (http://k2s.cc/file/fc3c3a9266ea0)
Title: Facesitting Bitches Pervy Policewoman
Post by: squidmanheis on March 02, 2017, 05:26:49 am
Facesitting Bitches - Pervy Policewoman

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/8/4cO8r/Facesitting%20Bitches%20-%20Pervy%20Policewoman_cover.jpg) (http://pimpandhost.com/image/62158003)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Pervy Policewoman
Runtime : 30min 56s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/8/4cO8z/Facesitting%20Bitches%20-%20Pervy%20Policewoman_thumb_0.jpg) (http://pimpandhost.com/image/62158011)

Download Links:

Facesitting Bitches - Pervy Policewoman.rar (http://k2s.cc/file/e4eaff1e04ce0)
Title: Facesitting Bitches Pole Dancer
Post by: squidmanheis on March 02, 2017, 08:51:50 am
Facesitting Bitches - Pole Dancer

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/9/4cO9L/Facesitting%20Bitches%20-%20Pole%20Dancer_cover.jpg) (http://pimpandhost.com/image/62158085)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Pole Dancer
Runtime : 30min 41s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/9/4cO9O/Facesitting%20Bitches%20-%20Pole%20Dancer_thumb_0.jpg) (http://pimpandhost.com/image/62158088)

Download Links:

Facesitting Bitches - Pole Dancer.rar (http://k2s.cc/file/ab4cb65d38597)
Title: Facesitting Bitches Policewomans Position
Post by: squidmanheis on March 02, 2017, 12:16:49 pm
Facesitting Bitches - Policewomans Position

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/a/4cOaU/Facesitting%20Bitches%20-%20Policewomans%20Position_cover.jpg) (http://pimpandhost.com/image/62158156)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Policewomans Position
Runtime : 29min 11s
File Size : 164 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/b/4cOb0/Facesitting%20Bitches%20-%20Policewomans%20Position_thumb_0.jpg) (http://pimpandhost.com/image/62158162)

Download Links:

Facesitting Bitches - Policewomans Position.rar (http://k2s.cc/file/47a9de13f6667)
Title: Facesitting Bitches Pressed Flat
Post by: squidmanheis on March 02, 2017, 03:41:46 pm
Facesitting Bitches - Pressed Flat

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/e/4cOe9/Facesitting%20Bitches%20-%20Pressed%20Flat_cover.jpg) (http://pimpandhost.com/image/62158357)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Pressed Flat
Runtime : 29min 33s
File Size : 165 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/e/4cOeb/Facesitting%20Bitches%20-%20Pressed%20Flat_thumb_0.jpg) (http://pimpandhost.com/image/62158359)

Download Links:

Facesitting Bitches - Pressed Flat.rar (http://k2s.cc/file/1eb357472b90f)
Title: Facesitting Bitches Pretty in Pink
Post by: squidmanheis on March 02, 2017, 07:06:49 pm
Facesitting Bitches - Pretty in Pink

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/h/4cOhH/Facesitting%20Bitches%20-%20Pretty%20in%20Pink_cover.jpg) (http://pimpandhost.com/image/62158577)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Pretty in Pink
Runtime : 30min 42s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/h/4cOhN/Facesitting%20Bitches%20-%20Pretty%20in%20Pink_thumb_0.jpg) (http://pimpandhost.com/image/62158583)

Download Links:

Facesitting Bitches - Pretty in Pink.rar (http://k2s.cc/file/cd30173bff640)
Title: Facesitting Bitches Private Dance
Post by: squidmanheis on March 02, 2017, 10:31:49 pm
Facesitting Bitches - Private Dance

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/l/4cOlZ/Facesitting%20Bitches%20-%20Private%20Dance%20_cover.jpg) (http://pimpandhost.com/image/62158843)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Private Dance
Runtime : 29min 52s
File Size : 167 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/m/4cOm1/Facesitting%20Bitches%20-%20Private%20Dance%20_thumb_0.jpg) (http://pimpandhost.com/image/62158845)

Download Links:

Facesitting Bitches - Private Dance .rar (http://k2s.cc/file/7565d93e002ba)
Title: Facesitting Bitches Rock and Roll
Post by: squidmanheis on March 03, 2017, 01:56:46 am
Facesitting Bitches - Rock and Roll

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/s/4cOsD/Facesitting%20Bitches%20-%20Rock%20and%20Roll_cover.jpg) (http://pimpandhost.com/image/62159255)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Rock and Roll
Runtime : 30min 36s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/s/4cOsF/Facesitting%20Bitches%20-%20Rock%20and%20Roll_thumb_0.jpg) (http://pimpandhost.com/image/62159257)

Download Links:

Facesitting Bitches - Rock and Roll.rar (http://k2s.cc/file/b00cd3a9436bf)
Title: Facesitting Bitches Room Service
Post by: squidmanheis on March 03, 2017, 05:21:46 am
Facesitting Bitches - Room Service

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/w/4cOwT/Facesitting%20Bitches%20-%20Room%20Service_cover.jpg) (http://pimpandhost.com/image/62159519)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Room Service
Runtime : 30min 22s
File Size : 170 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/w/4cOwV/Facesitting%20Bitches%20-%20Room%20Service_thumb_0.jpg) (http://pimpandhost.com/image/62159521)

Download Links:

Facesitting Bitches - Room Service.rar (http://k2s.cc/file/81eadb6b29a7e)
Title: Facesitting Bitches Sarahs First Facesit
Post by: squidmanheis on March 07, 2017, 11:13:25 am
Facesitting Bitches - Sarahs First Facesit

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/D/4cODm/Facesitting%20Bitches%20-%20Sarahs%20First%20Facesit_cover.jpg) (http://pimpandhost.com/image/62159920)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Sarahs First Facesit
Runtime : 31min 6s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/D/4cODp/Facesitting%20Bitches%20-%20Sarahs%20First%20Facesit_thumb_0.jpg) (http://pimpandhost.com/image/62159923)

Download Links:

Facesitting Bitches - Sarahs First Facesit.rar (http://k2s.cc/file/6570de1af092e)
Title: Facesitting Bitches Schoolgirl Smother
Post by: squidmanheis on March 07, 2017, 12:35:26 pm
Facesitting Bitches - Schoolgirl Smother

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/J/4cOJq/Facesitting%20Bitches%20-%20Schoolgirl%20Smother_cover.jpg) (http://pimpandhost.com/image/62160296)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Schoolgirl Smother
Runtime : 29min 53s
File Size : 167 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/J/4cOJs/Facesitting%20Bitches%20-%20Schoolgirl%20Smother_thumb_0.jpg) (http://pimpandhost.com/image/62160298)

Download Links:

Facesitting Bitches - Schoolgirl Smother.rar (http://k2s.cc/file/8be628fdada39)
Title: Facesitting Bitches Show Me Your Ass
Post by: squidmanheis on March 07, 2017, 03:51:50 pm
Facesitting Bitches - Show Me Your Ass

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/P/4cOPr/Facesitting%20Bitches%20-%20Show%20Me%20Your%20Ass_cover.jpg) (http://pimpandhost.com/image/62160669)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Show Me Your Ass
Runtime : 30min 43s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/P/4cOPu/Facesitting%20Bitches%20-%20Show%20Me%20Your%20Ass_thumb_0.jpg) (http://pimpandhost.com/image/62160672)

Download Links:

Facesitting Bitches - Show Me Your Ass.rar (http://k2s.cc/file/cf29a2fdd7a27)
Title: Facesitting Bitches Silencing The Prisoner
Post by: squidmanheis on March 07, 2017, 07:08:23 pm
Facesitting Bitches - Silencing The Prisoner

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/T/4cOTz/Facesitting%20Bitches%20-%20Silencing%20The%20Prisoner_cover.jpg) (http://pimpandhost.com/image/62160925)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Silencing The Prisoner
Runtime : 29min 12s
File Size : 164 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/T/4cOTC/Facesitting%20Bitches%20-%20Silencing%20The%20Prisoner_thumb_0.jpg) (http://pimpandhost.com/image/62160928)

Download Links:

Facesitting Bitches - Silencing The Prisoner.rar (http://k2s.cc/file/812c4b94ceef5)
Title: Facesitting Bitches Sit On Me
Post by: squidmanheis on March 07, 2017, 10:24:47 pm
Facesitting Bitches - Sit On Me

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/W/4cOW9/Facesitting%20Bitches%20-%20Sit%20On%20Me%20_cover.jpg) (http://pimpandhost.com/image/62161085)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Sit On Me
Runtime : 30min 54s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/W/4cOWa/Facesitting%20Bitches%20-%20Sit%20On%20Me%20_thumb_0.jpg) (http://pimpandhost.com/image/62161086)

Download Links:

Facesitting Bitches - Sit On Me .rar (http://k2s.cc/file/c496c9131cf7f)
Title: Facesitting Bitches Sitting Room Smother
Post by: squidmanheis on March 08, 2017, 01:41:29 am
Facesitting Bitches - Sitting Room Smother

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/W/4cOWL/Facesitting%20Bitches%20-%20Sitting%20Room%20Smother_cover.jpg) (http://pimpandhost.com/image/62161123)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Sitting Room Smother
Runtime : 30min 9s
File Size : 169 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/W/4cOWN/Facesitting%20Bitches%20-%20Sitting%20Room%20Smother_thumb_0.jpg) (http://pimpandhost.com/image/62161125)

Download Links:

Facesitting Bitches - Sitting Room Smother.rar (http://k2s.cc/file/88221df9ded02)
Title: Facesitting Bitches Smell My Dirty Panties
Post by: squidmanheis on March 08, 2017, 04:58:51 am
Facesitting Bitches - Smell My Dirty Panties

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/6/4cP68/Facesitting%20Bitches%20-%20Smell%20My%20Dirty%20Panties_cover.jpg) (http://pimpandhost.com/image/62161704)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Smell My Dirty Panties
Runtime : 29min 9s
File Size : 163 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/6/4cP6H/Facesitting%20Bitches%20-%20Smell%20My%20Dirty%20Panties_thumb_0.jpg) (http://pimpandhost.com/image/62161739)

Download Links:

Facesitting Bitches - Smell My Dirty Panties.rar (http://k2s.cc/file/7ae1cd0bd7b52)
Title: Facesitting Bitches Smell My Dirty Panties
Post by: squidmanheis on March 08, 2017, 04:58:58 am
Facesitting Bitches - Smell My Dirty Panties

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/6/4cP68/Facesitting%20Bitches%20-%20Smell%20My%20Dirty%20Panties_cover.jpg) (http://pimpandhost.com/image/62161704)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Smell My Dirty Panties
Runtime : 29min 9s
File Size : 163 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/6/4cP6H/Facesitting%20Bitches%20-%20Smell%20My%20Dirty%20Panties_thumb_0.jpg) (http://pimpandhost.com/image/62161739)

Download Links:

Facesitting Bitches - Smell My Dirty Panties.rar (http://k2s.cc/file/7ae1cd0bd7b52)
Title: Facesitting Bitches Smelling Her Dirty Laundry
Post by: squidmanheis on March 08, 2017, 08:14:18 am
Facesitting Bitches - Smelling Her Dirty Laundry

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/e/4cPe1/Facesitting%20Bitches%20-%20Smelling%20Her%20Dirty%20Laundry_cover.jpg) (http://pimpandhost.com/image/62162193)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Smelling Her Dirty Laundry
Runtime : 29min 49s
File Size : 167 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/e/4cPe3/Facesitting%20Bitches%20-%20Smelling%20Her%20Dirty%20Laundry_thumb_0.jpg) (http://pimpandhost.com/image/62162195)

Download Links:

Facesitting Bitches - Smelling Her Dirty Laundry.rar (http://k2s.cc/file/dbde329b8b8d5)
Title: Facesitting Bitches Smother Cop
Post by: squidmanheis on March 08, 2017, 11:30:59 am
Facesitting Bitches - Smother Cop

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/k/4cPku/Facesitting%20Bitches%20-%20Smother%20Cop_cover.jpg) (http://pimpandhost.com/image/62162594)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Smother Cop
Runtime : 30min 24s
File Size : 170 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/k/4cPkw/Facesitting%20Bitches%20-%20Smother%20Cop_thumb_0.jpg) (http://pimpandhost.com/image/62162596)

Download Links:

Facesitting Bitches - Smother Cop.rar (http://k2s.cc/file/93a19caa55246)
Title: Facesitting Bitches Smother Panties
Post by: squidmanheis on March 08, 2017, 02:47:09 pm
Facesitting Bitches - Smother Panties

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/r/4cPrP/Facesitting%20Bitches%20-%20Smother%20Panties_cover.jpg) (http://pimpandhost.com/image/62163049)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Smother Panties
Runtime : 30min 16s
File Size : 170 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/r/4cPrR/Facesitting%20Bitches%20-%20Smother%20Panties_thumb_0.jpg) (http://pimpandhost.com/image/62163051)

Download Links:

Facesitting Bitches - Smother Panties.rar (http://k2s.cc/file/6473df59a63ac)
Title: Facesitting Bitches Sniff it, Slave
Post by: squidmanheis on March 08, 2017, 06:04:12 pm
Facesitting Bitches - Sniff it, Slave

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/z/4cPz3/Facesitting%20Bitches%20-%20Sniff%20it_%20Slave_cover.jpg) (http://pimpandhost.com/image/62163497)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Sniff it, Slave
Runtime : 30min 57s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/z/4cPzW/Facesitting%20Bitches%20-%20Sniff%20it_%20Slave_thumb_0.jpg) (http://pimpandhost.com/image/62163552)

Download Links:

Facesitting Bitches - Sniff it, Slave.rar (http://k2s.cc/file/415d5ec608f7a)
Title: Facesitting Bitches Sniff it, Slave
Post by: squidmanheis on March 08, 2017, 06:04:48 pm
Facesitting Bitches - Sniff it, Slave

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/z/4cPz3/Facesitting%20Bitches%20-%20Sniff%20it_%20Slave_cover.jpg) (http://pimpandhost.com/image/62163497)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Sniff it, Slave
Runtime : 30min 57s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/z/4cPzW/Facesitting%20Bitches%20-%20Sniff%20it_%20Slave_thumb_0.jpg) (http://pimpandhost.com/image/62163552)

Download Links:

Facesitting Bitches - Sniff it, Slave.rar (http://k2s.cc/file/415d5ec608f7a)
Title: Facesitting Bitches So Last Season
Post by: squidmanheis on March 08, 2017, 09:20:04 pm
Facesitting Bitches - So Last Season

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/I/4cPI8/Facesitting%20Bitches%20-%20So%20Last%20Season_cover.jpg) (http://pimpandhost.com/image/62164060)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - So Last Season
Runtime : 30min 22s
File Size : 170 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/J/4cPJz/Facesitting%20Bitches%20-%20So%20Last%20Season_thumb_0.jpg) (http://pimpandhost.com/image/62164149)

Download Links:

Facesitting Bitches - So Last Season.rar (http://k2s.cc/file/2ed99e7aa22f4)
Title: Facesitting Bitches Spa Smother
Post by: squidmanheis on March 09, 2017, 12:36:28 am
Facesitting Bitches - Spa Smother

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/Q/4cPQY/Facesitting%20Bitches%20-%20Spa%20Smother_cover.jpg) (http://pimpandhost.com/image/62164608)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Spa Smother
Runtime : 30min 40s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/R/4cPR5/Facesitting%20Bitches%20-%20Spa%20Smother_thumb_0.jpg) (http://pimpandhost.com/image/62164615)

Download Links:

Facesitting Bitches - Spa Smother.rar (http://k2s.cc/file/1833d4b0fc156)
Title: Facesitting Bitches Squashed By Scarlet
Post by: squidmanheis on March 09, 2017, 03:52:58 am
Facesitting Bitches - Squashed By Scarlet

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/T/4cPTe/Facesitting%20Bitches%20-%20Squashed%20By%20Scarlet_cover.jpg) (http://pimpandhost.com/image/62164748)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Squashed By Scarlet
Runtime : 30min 29s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/T/4cPTf/Facesitting%20Bitches%20-%20Squashed%20By%20Scarlet_thumb_0.jpg) (http://pimpandhost.com/image/62164749)

Download Links:

Facesitting Bitches - Squashed By Scarlet.rar (http://k2s.cc/file/d58319673da9a)
Title: Facesitting Bitches Sun, Sea and Smothering
Post by: squidmanheis on March 09, 2017, 07:10:34 am
Facesitting Bitches - Sun, Sea and Smothering

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/W/4cPWb/Facesitting%20Bitches%20-%20Sun_%20Sea%20and%20Smothering_cover.jpg) (http://pimpandhost.com/image/62164931)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Sun, Sea and Smothering
Runtime : 29min 22s
File Size : 164 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/W/4cPWj/Facesitting%20Bitches%20-%20Sun_%20Sea%20and%20Smothering_thumb_0.jpg) (http://pimpandhost.com/image/62164939)

Download Links:

Facesitting Bitches - Sun, Sea and Smothering.rar (http://k2s.cc/file/61432814a8e92)
Title: Facesitting Bitches Sun, Sea and Smothering
Post by: squidmanheis on March 09, 2017, 07:10:34 am
Facesitting Bitches - Sun, Sea and Smothering

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/W/4cPWb/Facesitting%20Bitches%20-%20Sun_%20Sea%20and%20Smothering_cover.jpg) (http://pimpandhost.com/image/62164931)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Sun, Sea and Smothering
Runtime : 29min 22s
File Size : 164 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/W/4cPWj/Facesitting%20Bitches%20-%20Sun_%20Sea%20and%20Smothering_thumb_0.jpg) (http://pimpandhost.com/image/62164939)

Download Links:

Facesitting Bitches - Sun, Sea and Smothering.rar (http://k2s.cc/file/61432814a8e92)
Title: Facesitting Bitches Teachers Torment
Post by: squidmanheis on March 09, 2017, 10:26:51 am
Facesitting Bitches - Teachers Torment

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/2/4cQ2G/Facesitting%20Bitches%20-%20Teachers%20Torment_cover.jpg) (http://pimpandhost.com/image/62165334)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Teachers Torment
Runtime : 29min 52s
File Size : 167 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/2/4cQ2T/Facesitting%20Bitches%20-%20Teachers%20Torment_thumb_0.jpg) (http://pimpandhost.com/image/62165347)

Download Links:

Facesitting Bitches - Teachers Torment.rar (http://k2s.cc/file/cd0158cd073c4)
Title: Facesitting Bitches Teachers Torment
Post by: squidmanheis on March 09, 2017, 10:26:54 am
Facesitting Bitches - Teachers Torment

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/2/4cQ2G/Facesitting%20Bitches%20-%20Teachers%20Torment_cover.jpg) (http://pimpandhost.com/image/62165334)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Teachers Torment
Runtime : 29min 52s
File Size : 167 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/2/4cQ2T/Facesitting%20Bitches%20-%20Teachers%20Torment_thumb_0.jpg) (http://pimpandhost.com/image/62165347)

Download Links:

Facesitting Bitches - Teachers Torment.rar (http://k2s.cc/file/cd0158cd073c4)
Title: Facesitting Bitches That Friday Feeling
Post by: squidmanheis on March 09, 2017, 01:42:20 pm
Facesitting Bitches - That Friday Feeling

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/8/4cQ8P/Facesitting%20Bitches%20-%20That%20Friday%20Feeling_cover.jpg) (http://pimpandhost.com/image/62165715)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - That Friday Feeling
Runtime : 31min 6s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/9/4cQ9J/Facesitting%20Bitches%20-%20That%20Friday%20Feeling_thumb_0.jpg) (http://pimpandhost.com/image/62165771)

Download Links:

Facesitting Bitches - That Friday Feeling.rar (http://k2s.cc/file/60d7af16b365b)
Title: Facesitting Bitches The Bondage Salesman
Post by: squidmanheis on March 09, 2017, 04:58:45 pm
Facesitting Bitches - The Bondage Salesman

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/g/4cQgg/Facesitting%20Bitches%20-%20The%20Bondage%20Salesman_cover.jpg) (http://pimpandhost.com/image/62166176)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Bondage Salesman
Runtime : 31min 1s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/g/4cQgk/Facesitting%20Bitches%20-%20The%20Bondage%20Salesman_thumb_0.jpg) (http://pimpandhost.com/image/62166180)

Download Links:

Facesitting Bitches - The Bondage Salesman.rar (http://k2s.cc/file/8be2e69bce3f9)
Title: Facesitting Bitches The Bosss Bottom
Post by: squidmanheis on March 09, 2017, 08:16:20 pm
Facesitting Bitches - The Bosss Bottom

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/g/4cQgQ/Facesitting%20Bitches%20-%20The%20Bosss%20Bottom_cover.jpg) (http://pimpandhost.com/image/62166212)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Bosss Bottom
Runtime : 30min 51s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/g/4cQgS/Facesitting%20Bitches%20-%20The%20Bosss%20Bottom_thumb_0.jpg) (http://pimpandhost.com/image/62166214)

Download Links:

Facesitting Bitches - The Bosss Bottom.rar (http://k2s.cc/file/1d2f0c471d67a)
Title: Facesitting Bitches The Bosss Bottom
Post by: squidmanheis on March 09, 2017, 08:16:20 pm
Facesitting Bitches - The Bosss Bottom

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/g/4cQgQ/Facesitting%20Bitches%20-%20The%20Bosss%20Bottom_cover.jpg) (http://pimpandhost.com/image/62166212)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Bosss Bottom
Runtime : 30min 51s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/g/4cQgS/Facesitting%20Bitches%20-%20The%20Bosss%20Bottom_thumb_0.jpg) (http://pimpandhost.com/image/62166214)

Download Links:

Facesitting Bitches - The Bosss Bottom.rar (http://k2s.cc/file/1d2f0c471d67a)
Title: Facesitting Bitches The Counting Game
Post by: squidmanheis on March 09, 2017, 11:31:46 pm
Facesitting Bitches - The Counting Game

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/h/4cQhs/Facesitting%20Bitches%20-%20The%20Counting%20Game_cover.jpg) (http://pimpandhost.com/image/62166250)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Counting Game
Runtime : 30min 40s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/h/4cQhu/Facesitting%20Bitches%20-%20The%20Counting%20Game_thumb_0.jpg) (http://pimpandhost.com/image/62166252)

Download Links:

Facesitting Bitches - The Counting Game.rar (http://k2s.cc/file/f539d4a51315d)
Title: Facesitting Bitches The Hitchhiker
Post by: squidmanheis on March 10, 2017, 02:48:01 am
Facesitting Bitches - The Hitchhiker

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/k/4cQkr/Facesitting%20Bitches%20-%20The%20Hitchhiker_cover.jpg) (http://pimpandhost.com/image/62166435)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Hitchhiker
Runtime : 29min 58s
File Size : 168 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/k/4cQks/Facesitting%20Bitches%20-%20The%20Hitchhiker_thumb_0.jpg) (http://pimpandhost.com/image/62166436)

Download Links:

Facesitting Bitches - The Hitchhiker.rar (http://k2s.cc/file/f06254fbc9fdd)
Title: Facesitting Bitches The Knicker Tester
Post by: squidmanheis on March 10, 2017, 06:04:21 am
Facesitting Bitches - The Knicker Tester

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/k/4cQkY/Facesitting%20Bitches%20-%20The%20Knicker%20Tester_cover.jpg) (http://pimpandhost.com/image/62166468)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Knicker Tester
Runtime : 26min 36s
File Size : 149 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/k/4cQkZ/Facesitting%20Bitches%20-%20The%20Knicker%20Tester_thumb_0.jpg) (http://pimpandhost.com/image/62166469)

Download Links:

Facesitting Bitches - The Knicker Tester.rar (http://k2s.cc/file/86a842c07eaf3)
Title: Facesitting Bitches The Office Geek
Post by: squidmanheis on March 10, 2017, 09:20:51 am
Facesitting Bitches - The Office Geek

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/l/4cQlM/Facesitting%20Bitches%20-%20The%20Office%20Geek_cover.jpg) (http://pimpandhost.com/image/62166518)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Office Geek
Runtime : 30min 44s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/l/4cQlN/Facesitting%20Bitches%20-%20The%20Office%20Geek_thumb_0.jpg) (http://pimpandhost.com/image/62166519)

Download Links:

Facesitting Bitches - The Office Geek.rar (http://k2s.cc/file/25e30d0fb3e78)
Title: Facesitting Bitches The Proposal
Post by: squidmanheis on March 10, 2017, 12:38:21 pm
Facesitting Bitches - The Proposal

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/n/4cQnk/Facesitting%20Bitches%20-%20The%20Proposal_cover.jpg) (http://pimpandhost.com/image/62166614)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Proposal
Runtime : 30min 28s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/n/4cQnl/Facesitting%20Bitches%20-%20The%20Proposal_thumb_0.jpg) (http://pimpandhost.com/image/62166615)

Download Links:

Facesitting Bitches - The Proposal.rar (http://k2s.cc/file/7f289b9e7a53b)
Title: Facesitting Bitches The Proposal
Post by: squidmanheis on March 10, 2017, 12:39:18 pm
Facesitting Bitches - The Proposal

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/n/4cQnk/Facesitting%20Bitches%20-%20The%20Proposal_cover.jpg) (http://pimpandhost.com/image/62166614)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Proposal
Runtime : 30min 28s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/n/4cQnl/Facesitting%20Bitches%20-%20The%20Proposal_thumb_0.jpg) (http://pimpandhost.com/image/62166615)

Download Links:

Facesitting Bitches - The Proposal.rar (http://k2s.cc/file/7f289b9e7a53b)
Title: Facesitting Bitches The Proposal
Post by: squidmanheis on March 10, 2017, 12:39:23 pm
Facesitting Bitches - The Proposal

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/n/4cQnk/Facesitting%20Bitches%20-%20The%20Proposal_cover.jpg) (http://pimpandhost.com/image/62166614)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Proposal
Runtime : 30min 28s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/n/4cQnl/Facesitting%20Bitches%20-%20The%20Proposal_thumb_0.jpg) (http://pimpandhost.com/image/62166615)

Download Links:

Facesitting Bitches - The Proposal.rar (http://k2s.cc/file/7f289b9e7a53b)
Title: Facesitting Bitches Two Days Wear
Post by: squidmanheis on March 10, 2017, 03:53:37 pm
Facesitting Bitches - Two Days Wear

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/o/4cQol/Facesitting%20Bitches%20-%20Two%20Days%20Wear_cover.jpg) (http://pimpandhost.com/image/62166677)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Two Days Wear
Runtime : 30min 58s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/o/4cQoo/Facesitting%20Bitches%20-%20Two%20Days%20Wear_thumb_0.jpg) (http://pimpandhost.com/image/62166680)

Download Links:

Facesitting Bitches - Two Days Wear.rar (http://k2s.cc/file/0b2470ad2d021)
Title: Facesitting Bitches Used and Abused
Post by: squidmanheis on March 10, 2017, 07:10:12 pm
Facesitting Bitches - Used and Abused

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/p/4cQpn/Facesitting%20Bitches%20-%20Used%20and%20Abused_cover.jpg) (http://pimpandhost.com/image/62166741)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Used and Abused
Runtime : 31min 7s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/p/4cQpo/Facesitting%20Bitches%20-%20Used%20and%20Abused_thumb_0.jpg) (http://pimpandhost.com/image/62166742)

Download Links:

Facesitting Bitches - Used and Abused.rar (http://k2s.cc/file/7ce1a10535b24)
Title: Facesitting Bitches Washed Up
Post by: squidmanheis on March 10, 2017, 10:26:34 pm
Facesitting Bitches - Washed Up

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/r/4cQrs/Facesitting%20Bitches%20-%20Washed%20Up_cover.jpg) (http://pimpandhost.com/image/62166870)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Washed Up
Runtime : 30min 47s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/r/4cQrv/Facesitting%20Bitches%20-%20Washed%20Up_thumb_0.jpg) (http://pimpandhost.com/image/62166873)

Download Links:

Facesitting Bitches - Washed Up.rar (http://k2s.cc/file/7674d47687473)
Title: Facesitting Bitches When Im Cleaning Windows
Post by: squidmanheis on March 11, 2017, 01:43:02 am
Facesitting Bitches - When Im Cleaning Windows

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/s/4cQsx/Facesitting%20Bitches%20-%20When%20Im%20Cleaning%20Windows_cover.jpg) (http://pimpandhost.com/image/62166937)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - When Im Cleaning Windows
Runtime : 28min 27s
File Size : 159 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/s/4cQsy/Facesitting%20Bitches%20-%20When%20Im%20Cleaning%20Windows_thumb_0.jpg) (http://pimpandhost.com/image/62166938)

Download Links:

Facesitting Bitches - When Im Cleaning Windows.rar (http://k2s.cc/file/964694ac02a5d)
Title: Facesitting Bitches You Are Sniffing My Ass
Post by: squidmanheis on March 11, 2017, 04:59:19 am
Facesitting Bitches - You Are Sniffing My Ass

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/s/4cQsR/Facesitting%20Bitches%20-%20You%20Are%20Sniffing%20My%20Ass_cover.jpg) (http://pimpandhost.com/image/62166957)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - You Are Sniffing My Ass
Runtime : 30min 58s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/t/4cQt3/Facesitting%20Bitches%20-%20You%20Are%20Sniffing%20My%20Ass_thumb_0.jpg) (http://pimpandhost.com/image/62166969)

Download Links:

Facesitting Bitches - You Are Sniffing My Ass.rar (http://k2s.cc/file/f522e42c34724)
Title: Facesitting Bitches You Can Wait
Post by: squidmanheis on March 11, 2017, 08:08:51 am
Facesitting Bitches - You Can Wait

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/t/4cQtE/Facesitting%20Bitches%20-%20You%20Can%20Wait_cover.jpg) (http://pimpandhost.com/image/62167006)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - You Can Wait
Runtime : 28min 28s
File Size : 159 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/t/4cQtH/Facesitting%20Bitches%20-%20You%20Can%20Wait_thumb_0.jpg) (http://pimpandhost.com/image/62167009)

Download Links:

Facesitting Bitches - You Can Wait.rar (http://k2s.cc/file/8199ec209713a)
Title: Facesitting Bitches You Cannot Be Dominant
Post by: squidmanheis on March 11, 2017, 11:11:20 am
Facesitting Bitches - You Cannot Be Dominant

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/u/4cQuj/Facesitting%20Bitches%20-%20You%20Cannot%20Be%20Dominant_cover.jpg) (http://pimpandhost.com/image/62167047)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - You Cannot Be Dominant
Runtime : 31min 3s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/u/4cQuk/Facesitting%20Bitches%20-%20You%20Cannot%20Be%20Dominant_thumb_0.jpg) (http://pimpandhost.com/image/62167048)

Download Links:

Facesitting Bitches - You Cannot Be Dominant.rar (http://k2s.cc/file/dae9d7464ecc6)
Title: Facesitting Bitches You For Coffee
Post by: squidmanheis on March 11, 2017, 02:13:46 pm
Facesitting Bitches - You For Coffee

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/u/4cQuO/Facesitting%20Bitches%20-%20You%20For%20Coffee_cover.jpg) (http://pimpandhost.com/image/62167078)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - You For Coffee
Runtime : 30min 44s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/u/4cQuQ/Facesitting%20Bitches%20-%20You%20For%20Coffee_thumb_0.jpg) (http://pimpandhost.com/image/62167080)

Download Links:

Facesitting Bitches - You For Coffee.rar (http://k2s.cc/file/cbe68336db754)
Title: Facesitting Bitches You Were Looking
Post by: squidmanheis on March 11, 2017, 05:09:08 pm
Facesitting Bitches - You Were Looking

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/v/4cQvh/Facesitting%20Bitches%20-%20You%20Were%20Looking_cover.jpg) (http://pimpandhost.com/image/62167107)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - You Were Looking
Runtime : 30min 35s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/v/4cQvi/Facesitting%20Bitches%20-%20You%20Were%20Looking_thumb_0.jpg) (http://pimpandhost.com/image/62167108)

Download Links:

Facesitting Bitches - You Were Looking.rar (http://k2s.cc/file/8cd9636cb3643)
Title: Facesitting Oksana 002 004
Post by: squidmanheis on March 11, 2017, 08:04:25 pm
Facesitting Oksana 002-004

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/v/4cQvL/Facesitting%20Oksana%20002-004_cover.jpg) (http://pimpandhost.com/image/62167137)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Oksana 002-004
Runtime : 3min 0s
File Size : 30.4 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/v/4cQvN/Facesitting%20Oksana%20002-004_thumb_0.jpg) (http://pimpandhost.com/image/62167139)

Download Links:

Facesitting Oksana 002-004.rar (http://k2s.cc/file/e61cdbd7ace65)
Title: Facesitting sveta brusser ksusha galushko
Post by: squidmanheis on March 11, 2017, 10:52:49 pm
Facesitting sveta brusser ksusha galushko

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/v/4cQvQ/Facesitting%20sveta%20brusser%20ksusha%20galushko_cover.jpg) (http://pimpandhost.com/image/62167142)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting sveta brusser ksusha galushko
Runtime : 18min 10s
File Size : 139 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/v/4cQvS/Facesitting%20sveta%20brusser%20ksusha%20galushko_thumb_0.jpg) (http://pimpandhost.com/image/62167144)

Download Links:

Facesitting sveta brusser ksusha galushko.rar (http://k2s.cc/file/d78291b9a3e56)
Title: Facesitting Bitches An Introduction to Fullweight
Post by: squidmanheis on April 17, 2017, 12:16:57 am
Facesitting Bitches - An Introduction to Fullweight

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/y/4gCyP/Facesitting%20Bitches%20-%20An%20Introduction%20to%20Fullweight_cover.jpg) (http://pimpandhost.com/image/63066823)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - An Introduction to Fullweight
Runtime : 32min 39s
File Size : 183 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/y/4gCyR/Facesitting%20Bitches%20-%20An%20Introduction%20to%20Fullweight_thumb_0.jpg) (http://pimpandhost.com/image/63066825)

Download Links:

Facesitting Bitches - An Introduction to Fullweight.rar (http://k2s.cc/file/e5d2b5f8e2dcb)
Title: Facesitting Bitches Bad Influence
Post by: squidmanheis on April 17, 2017, 03:17:01 am
Facesitting Bitches - Bad Influence

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/A/4gCA4/Facesitting%20Bitches%20-%20Bad%20Influence_cover.jpg) (http://pimpandhost.com/image/63066900)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Bad Influence
Runtime : 31min 54s
File Size : 179 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/A/4gCAa/Facesitting%20Bitches%20-%20Bad%20Influence_thumb_0.jpg) (http://pimpandhost.com/image/63066906)

Download Links:

Facesitting Bitches - Bad Influence.rar (http://k2s.cc/file/18edebdc4f6e0)
Title: Facesitting Bitches Balloon Party
Post by: squidmanheis on April 17, 2017, 06:17:00 am
Facesitting Bitches - Balloon Party

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/C/4gCCn/Facesitting%20Bitches%20-%20Balloon%20Party_cover.jpg) (http://pimpandhost.com/image/63067043)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Balloon Party
Runtime : 32min 4s
File Size : 180 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/C/4gCCu/Facesitting%20Bitches%20-%20Balloon%20Party_thumb_0.jpg) (http://pimpandhost.com/image/63067050)

Download Links:

Facesitting Bitches - Balloon Party.rar (http://k2s.cc/file/a7e3b96e5365c)
Title: Facesitting Bitches Beckys Beastly Boss
Post by: squidmanheis on April 17, 2017, 09:16:59 am
Facesitting Bitches - Beckys Beastly Boss

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/F/4gCFj/Facesitting%20Bitches%20-%20Beckys%20Beastly%20Boss_cover.jpg) (http://pimpandhost.com/image/63067225)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Beckys Beastly Boss
Runtime : 31min 16s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/F/4gCFn/Facesitting%20Bitches%20-%20Beckys%20Beastly%20Boss_thumb_0.jpg) (http://pimpandhost.com/image/63067229)

Download Links:

Facesitting Bitches - Beckys Beastly Boss.rar (http://k2s.cc/file/2943083e10618)
Title: Facesitting Bitches Big Booty
Post by: squidmanheis on April 17, 2017, 12:16:56 pm
Facesitting Bitches - Big Booty

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/J/4gCJ0/Facesitting%20Bitches%20-%20Big%20Booty%20_cover.jpg) (http://pimpandhost.com/image/63067454)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Big Booty
Runtime : 31min 42s
File Size : 178 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/J/4gCJf/Facesitting%20Bitches%20-%20Big%20Booty%20_thumb_0.jpg) (http://pimpandhost.com/image/63067469)

Download Links:

Facesitting Bitches - Big Booty .rar (http://k2s.cc/file/e23807cd3b12c)
Title: Facesitting Bitches Blind Date
Post by: squidmanheis on April 17, 2017, 03:16:57 pm
Facesitting Bitches - Blind Date

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/N/4gCNJ/Facesitting%20Bitches%20-%20Blind%20Date_cover.jpg) (http://pimpandhost.com/image/63067747)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Blind Date
Runtime : 31min 30s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/N/4gCNS/Facesitting%20Bitches%20-%20Blind%20Date_thumb_0.jpg) (http://pimpandhost.com/image/63067756)

Download Links:

Facesitting Bitches - Blind Date.rar (http://k2s.cc/file/82df9ecb38781)
Title: Facesitting Bitches Breakfast In Bed
Post by: squidmanheis on April 17, 2017, 06:16:58 pm
Facesitting Bitches - Breakfast In Bed

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/R/4gCRX/Facesitting%20Bitches%20-%20Breakfast%20In%20Bed_cover.jpg) (http://pimpandhost.com/image/63068009)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Breakfast In Bed
Runtime : 33min 1s
File Size : 185 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/S/4gCS3/Facesitting%20Bitches%20-%20Breakfast%20In%20Bed_thumb_0.jpg) (http://pimpandhost.com/image/63068015)

Download Links:

Facesitting Bitches - Breakfast In Bed.rar (http://k2s.cc/file/3528580151392)
Title: Facesitting Bitches Christmas Do
Post by: squidmanheis on April 17, 2017, 09:17:00 pm
Facesitting Bitches - Christmas Do

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/W/4gCW0/Facesitting%20Bitches%20-%20Christmas%20Do_cover.jpg) (http://pimpandhost.com/image/63068260)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Christmas Do
Runtime : 31min 32s
File Size : 177 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/W/4gCWa/Facesitting%20Bitches%20-%20Christmas%20Do_thumb_0.jpg) (http://pimpandhost.com/image/63068270)

Download Links:

Facesitting Bitches - Christmas Do.rar (http://k2s.cc/file/f2fb2756acda5)
Title: Facesitting Bitches Cuffed and Smothered
Post by: squidmanheis on April 18, 2017, 12:16:57 am
Facesitting Bitches - Cuffed and Smothered

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/Z/4gCZD/Facesitting%20Bitches%20-%20Cuffed%20and%20Smothered_cover.jpg) (http://pimpandhost.com/image/63068485)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Cuffed and Smothered
Runtime : 31min 25s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/C/Z/4gCZH/Facesitting%20Bitches%20-%20Cuffed%20and%20Smothered_thumb_0.jpg) (http://pimpandhost.com/image/63068489)

Download Links:

Facesitting Bitches - Cuffed and Smothered.rar (http://k2s.cc/file/920a7524a93f6)
Title: Facesitting Bitches Denim Double
Post by: squidmanheis on April 18, 2017, 03:16:57 am
Facesitting Bitches - Denim Double

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/3/4gD3T/Facesitting%20Bitches%20-%20Denim%20Double_cover.jpg) (http://pimpandhost.com/image/63068749)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Denim Double
Runtime : 32min 51s
File Size : 184 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/4/4gD43/Facesitting%20Bitches%20-%20Denim%20Double_thumb_0.jpg) (http://pimpandhost.com/image/63068759)

Download Links:

Facesitting Bitches - Denim Double.rar (http://k2s.cc/file/5f2c5513db34e)
Title: Facesitting Bitches Detention
Post by: squidmanheis on April 18, 2017, 06:16:57 am
Facesitting Bitches - Detention

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/8/4gD8c/Facesitting%20Bitches%20-%20Detention_cover.jpg) (http://pimpandhost.com/image/63069016)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Detention
Runtime : 32min 33s
File Size : 182 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/8/4gD8g/Facesitting%20Bitches%20-%20Detention_thumb_0.jpg) (http://pimpandhost.com/image/63069020)

Download Links:

Facesitting Bitches - Detention.rar (http://k2s.cc/file/0dd104e089eb8)
Title: Facesitting Bitches Doctor Pressure
Post by: squidmanheis on April 18, 2017, 09:16:55 am
Facesitting Bitches - Doctor Pressure

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/a/4gDaA/Facesitting%20Bitches%20-%20Doctor%20Pressure_cover.jpg) (http://pimpandhost.com/image/63069164)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Doctor Pressure
Runtime : 31min 51s
File Size : 178 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/a/4gDaC/Facesitting%20Bitches%20-%20Doctor%20Pressure_thumb_0.jpg) (http://pimpandhost.com/image/63069166)

Download Links:

Facesitting Bitches - Doctor Pressure.rar (http://k2s.cc/file/a20979f0618cc)
Title: Facesitting Bitches Facesitting Fitness
Post by: squidmanheis on April 18, 2017, 12:16:52 pm
Facesitting Bitches - Facesitting Fitness

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/b/4gDbJ/Facesitting%20Bitches%20-%20Facesitting%20Fitness_cover.jpg) (http://pimpandhost.com/image/63069235)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Facesitting Fitness
Runtime : 33min 19s
File Size : 187 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/b/4gDbL/Facesitting%20Bitches%20-%20Facesitting%20Fitness_thumb_0.jpg) (http://pimpandhost.com/image/63069237)

Download Links:

Facesitting Bitches - Facesitting Fitness.rar (http://k2s.cc/file/d91be00b1db65)
Title: Facesitting Bitches Flattened Flasher
Post by: squidmanheis on April 18, 2017, 03:17:00 pm
Facesitting Bitches - Flattened Flasher

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/c/4gDcG/Facesitting%20Bitches%20-%20Flattened%20Flasher_cover.jpg) (http://pimpandhost.com/image/63069294)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Flattened Flasher
Runtime : 31min 20s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/c/4gDcK/Facesitting%20Bitches%20-%20Flattened%20Flasher_thumb_0.jpg) (http://pimpandhost.com/image/63069298)

Download Links:

Facesitting Bitches - Flattened Flasher.rar (http://k2s.cc/file/0e6cbf56462b8)
Title: Facesitting Bitches I Can Take It
Post by: squidmanheis on April 18, 2017, 06:16:57 pm
Facesitting Bitches - I Can Take It

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/e/4gDek/Facesitting%20Bitches%20-%20I%20Can%20Take%20It_cover.jpg) (http://pimpandhost.com/image/63069396)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - I Can Take It
Runtime : 32min 5s
File Size : 180 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/e/4gDen/Facesitting%20Bitches%20-%20I%20Can%20Take%20It_thumb_0.jpg) (http://pimpandhost.com/image/63069399)

Download Links:

Facesitting Bitches - I Can Take It.rar (http://k2s.cc/file/72bbdd3e5f5ec)
Title: Facesitting Bitches I Dont Do Tattoos
Post by: squidmanheis on April 18, 2017, 09:16:53 pm
Facesitting Bitches - I Dont Do Tattoos

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/g/4gDgd/Facesitting%20Bitches%20-%20I%20Dont%20Do%20Tattoos_cover.jpg) (http://pimpandhost.com/image/63069513)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - I Dont Do Tattoos
Runtime : 31min 36s
File Size : 177 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/g/4gDgg/Facesitting%20Bitches%20-%20I%20Dont%20Do%20Tattoos_thumb_0.jpg) (http://pimpandhost.com/image/63069516)

Download Links:

Facesitting Bitches - I Dont Do Tattoos.rar (http://k2s.cc/file/0a411773e711a)
Title: Facesitting Bitches Jack The Lad
Post by: squidmanheis on April 19, 2017, 12:16:56 am
Facesitting Bitches - Jack The Lad

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/i/4gDiW/Facesitting%20Bitches%20-%20Jack%20The%20Lad_cover.jpg) (http://pimpandhost.com/image/63069682)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Jack The Lad
Runtime : 32min 38s
File Size : 183 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/j/4gDj0/Facesitting%20Bitches%20-%20Jack%20The%20Lad_thumb_0.jpg) (http://pimpandhost.com/image/63069686)

Download Links:

Facesitting Bitches - Jack The Lad.rar (http://k2s.cc/file/f59eebe5870ad)
Title: Facesitting Bitches Jessicas Bad Day
Post by: squidmanheis on April 19, 2017, 03:17:01 am
Facesitting Bitches - Jessicas Bad Day

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/k/4gDkE/Facesitting%20Bitches%20-%20Jessicas%20Bad%20Day_cover.jpg) (http://pimpandhost.com/image/63069788)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Jessicas Bad Day
Runtime : 32min 17s
File Size : 181 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/k/4gDkJ/Facesitting%20Bitches%20-%20Jessicas%20Bad%20Day_thumb_0.jpg) (http://pimpandhost.com/image/63069793)

Download Links:

Facesitting Bitches - Jessicas Bad Day.rar (http://k2s.cc/file/40be368c1cdbe)
Title: Facesitting Bitches Jogger Jessica
Post by: squidmanheis on April 19, 2017, 06:16:54 am
Facesitting Bitches - Jogger Jessica

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/m/4gDmf/Facesitting%20Bitches%20-%20Jogger%20Jessica_cover.jpg) (http://pimpandhost.com/image/63069887)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Jogger Jessica
Runtime : 31min 30s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/m/4gDmi/Facesitting%20Bitches%20-%20Jogger%20Jessica_thumb_0.jpg) (http://pimpandhost.com/image/63069890)

Download Links:

Facesitting Bitches - Jogger Jessica.rar (http://k2s.cc/file/6af9fae74d230)
Title: Facesitting Bitches Lawn Mower Man
Post by: squidmanheis on April 19, 2017, 09:16:52 am
Facesitting Bitches - Lawn Mower Man

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/n/4gDnW/Facesitting%20Bitches%20-%20Lawn%20Mower%20Man_cover.jpg) (http://pimpandhost.com/image/63069992)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Lawn Mower Man
Runtime : 31min 18s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/o/4gDo0/Facesitting%20Bitches%20-%20Lawn%20Mower%20Man_thumb_0.jpg) (http://pimpandhost.com/image/63069996)

Download Links:

Facesitting Bitches - Lawn Mower Man.rar (http://k2s.cc/file/013e46ddf8881)
Title: Facesitting Bitches Lazy Slave
Post by: squidmanheis on April 19, 2017, 12:17:25 pm
Facesitting Bitches - Lazy Slave

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/p/4gDpS/Facesitting%20Bitches%20-%20Lazy%20Slave_cover.jpg) (http://pimpandhost.com/image/63070112)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Lazy Slave
Runtime : 32min 44s
File Size : 183 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/p/4gDpY/Facesitting%20Bitches%20-%20Lazy%20Slave_thumb_0.jpg) (http://pimpandhost.com/image/63070118)

Download Links:

Facesitting Bitches - Lazy Slave.rar (http://k2s.cc/file/1560b8217200a)
Title: Facesitting Bitches More Pussy
Post by: squidmanheis on April 19, 2017, 03:17:22 pm
Facesitting Bitches - More Pussy

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/r/4gDrE/Facesitting%20Bitches%20-%20More%20Pussy_cover.jpg) (http://pimpandhost.com/image/63070222)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - More Pussy
Runtime : 31min 26s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/r/4gDrG/Facesitting%20Bitches%20-%20More%20Pussy_thumb_0.jpg) (http://pimpandhost.com/image/63070224)

Download Links:

Facesitting Bitches - More Pussy.rar (http://k2s.cc/file/fe73932630d22)
Title: Facesitting Bitches Naughty Nurse Belle
Post by: squidmanheis on April 19, 2017, 06:17:24 pm
Facesitting Bitches - Naughty Nurse Belle

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/t/4gDtp/Facesitting%20Bitches%20-%20Naughty%20Nurse%20Belle_cover.jpg) (http://pimpandhost.com/image/63070331)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Naughty Nurse Belle
Runtime : 32min 45s
File Size : 184 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/t/4gDtv/Facesitting%20Bitches%20-%20Naughty%20Nurse%20Belle_thumb_0.jpg) (http://pimpandhost.com/image/63070337)

Download Links:

Facesitting Bitches - Naughty Nurse Belle.rar (http://k2s.cc/file/8ac1ba20f2553)
Title: Facesitting Bitches Over The Top
Post by: squidmanheis on April 19, 2017, 09:41:17 pm
Facesitting Bitches - Over The Top

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/w/4gDwh/Facesitting%20Bitches%20-%20Over%20The%20Top_cover.jpg) (http://pimpandhost.com/image/63070509)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Over The Top
Runtime : 31min 43s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/w/4gDwk/Facesitting%20Bitches%20-%20Over%20The%20Top_thumb_0.jpg) (http://pimpandhost.com/image/63070512)

Download Links:

Facesitting Bitches - Over The Top.rar (http://k2s.cc/file/6cc87668e79d7)
Title: Facesitting Bitches Panty Raid
Post by: squidmanheis on April 20, 2017, 12:57:27 am
Facesitting Bitches - Panty Raid

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/y/4gDyS/Facesitting%20Bitches%20-%20Panty%20Raid_cover.jpg) (http://pimpandhost.com/image/63070670)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Panty Raid
Runtime : 31min 39s
File Size : 177 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/y/4gDyW/Facesitting%20Bitches%20-%20Panty%20Raid_thumb_0.jpg) (http://pimpandhost.com/image/63070674)

Download Links:

Facesitting Bitches - Panty Raid.rar (http://k2s.cc/file/3071defbf4a32)
Title: Facesitting Bitches Pay Up
Post by: squidmanheis on April 20, 2017, 04:13:54 am
Facesitting Bitches - Pay Up

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/B/4gDBQ/Facesitting%20Bitches%20-%20Pay%20Up_cover.jpg) (http://pimpandhost.com/image/63070854)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Pay Up
Runtime : 31min 14s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/B/4gDBV/Facesitting%20Bitches%20-%20Pay%20Up_thumb_0.jpg) (http://pimpandhost.com/image/63070859)

Download Links:

Facesitting Bitches - Pay Up.rar (http://k2s.cc/file/4acfa354f3040)
Title: Facesitting Bitches Pizza Freak
Post by: squidmanheis on April 20, 2017, 07:30:21 am
Facesitting Bitches - Pizza Freak

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/E/4gDE3/Facesitting%20Bitches%20-%20Pizza%20Freak_cover.jpg) (http://pimpandhost.com/image/63070991)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Pizza Freak
Runtime : 32min 10s
File Size : 180 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/E/4gDEa/Facesitting%20Bitches%20-%20Pizza%20Freak_thumb_0.jpg) (http://pimpandhost.com/image/63070998)

Download Links:

Facesitting Bitches - Pizza Freak.rar (http://k2s.cc/file/85540fd1dd907)
Title: Facesitting Bitches Project Smotherbox
Post by: squidmanheis on April 20, 2017, 10:46:42 am
Facesitting Bitches - Project Smotherbox

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/G/4gDGb/Facesitting%20Bitches%20-%20Project%20Smotherbox_cover.jpg) (http://pimpandhost.com/image/63071123)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Project Smotherbox
Runtime : 31min 41s
File Size : 178 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/G/4gDGe/Facesitting%20Bitches%20-%20Project%20Smotherbox_thumb_0.jpg) (http://pimpandhost.com/image/63071126)

Download Links:

Facesitting Bitches - Project Smotherbox.rar (http://k2s.cc/file/c68c5bc265dce)
Title: Facesitting Bitches Put in his Place
Post by: squidmanheis on April 20, 2017, 02:03:10 pm
Facesitting Bitches - Put in his Place

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/I/4gDIf/Facesitting%20Bitches%20-%20Put%20in%20his%20Place_cover.jpg) (http://pimpandhost.com/image/63071251)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Put in his Place
Runtime : 31min 27s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/I/4gDIj/Facesitting%20Bitches%20-%20Put%20in%20his%20Place_thumb_0.jpg) (http://pimpandhost.com/image/63071255)

Download Links:

Facesitting Bitches - Put in his Place.rar (http://k2s.cc/file/8208a56a6670c)
Title: Facesitting Bitches PVC Bitches
Post by: squidmanheis on April 20, 2017, 05:19:30 pm
Facesitting Bitches - PVC Bitches

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/K/4gDKg/Facesitting%20Bitches%20-%20PVC%20Bitches_cover.jpg) (http://pimpandhost.com/image/63071376)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - PVC Bitches
Runtime : 32min 54s
File Size : 184 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/K/4gDKi/Facesitting%20Bitches%20-%20PVC%20Bitches_thumb_0.jpg) (http://pimpandhost.com/image/63071378)

Download Links:

Facesitting Bitches - PVC Bitches.rar (http://k2s.cc/file/58b31785569ef)
Title: Facesitting Bitches Rude Awakening
Post by: squidmanheis on April 20, 2017, 08:36:05 pm
Facesitting Bitches - Rude Awakening

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/M/4gDMn/Facesitting%20Bitches%20-%20Rude%20Awakening_cover.jpg) (http://pimpandhost.com/image/63071507)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Rude Awakening
Runtime : 31min 16s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/M/4gDMs/Facesitting%20Bitches%20-%20Rude%20Awakening_thumb_0.jpg) (http://pimpandhost.com/image/63071512)

Download Links:

Facesitting Bitches - Rude Awakening.rar (http://k2s.cc/file/1632478de82bb)
Title: Facesitting Bitches Rude Santa
Post by: squidmanheis on April 21, 2017, 05:12:20 am
Facesitting Bitches - Rude Santa

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/O/4gDOE/Facesitting%20Bitches%20-%20Rude%20Santa_cover.jpg) (http://pimpandhost.com/image/63071648)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Rude Santa
Runtime : 31min 18s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/O/4gDOJ/Facesitting%20Bitches%20-%20Rude%20Santa_thumb_0.jpg) (http://pimpandhost.com/image/63071653)

Download Links:

Facesitting Bitches - Rude Santa.rar (http://k2s.cc/file/4fb13f2630f82)
Title: Facesitting Bitches Seaside Smother
Post by: squidmanheis on April 21, 2017, 05:57:33 am
Facesitting Bitches - Seaside Smother

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/Q/4gDQR/Facesitting%20Bitches%20-%20Seaside%20Smother_cover.jpg) (http://pimpandhost.com/image/63071785)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Seaside Smother
Runtime : 31min 15s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/Q/4gDQW/Facesitting%20Bitches%20-%20Seaside%20Smother_thumb_0.jpg) (http://pimpandhost.com/image/63071790)

Download Links:

Facesitting Bitches - Seaside Smother.rar (http://k2s.cc/file/7b2a76553e33b)
Title: Facesitting Bitches Shower Smother
Post by: squidmanheis on April 21, 2017, 07:59:48 am
Facesitting Bitches - Shower Smother

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/S/4gDSM/Facesitting%20Bitches%20-%20Shower%20Smother_cover.jpg) (http://pimpandhost.com/image/63071904)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Shower Smother
Runtime : 31min 41s
File Size : 178 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/S/4gDST/Facesitting%20Bitches%20-%20Shower%20Smother_thumb_0.jpg) (http://pimpandhost.com/image/63071911)

Download Links:

Facesitting Bitches - Shower Smother.rar (http://k2s.cc/file/05597da1a130f)
Title: Facesitting Bitches Silky Smother
Post by: squidmanheis on April 21, 2017, 11:16:13 am
Facesitting Bitches - Silky Smother

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/U/4gDUO/Facesitting%20Bitches%20-%20Silky%20Smother_cover.jpg) (http://pimpandhost.com/image/63072030)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Silky Smother
Runtime : 31min 48s
File Size : 178 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/U/4gDUS/Facesitting%20Bitches%20-%20Silky%20Smother_thumb_0.jpg) (http://pimpandhost.com/image/63072034)

Download Links:

Facesitting Bitches - Silky Smother.rar (http://k2s.cc/file/e646ecc7856da)
Title: Facesitting Bitches Smothered Slave
Post by: squidmanheis on April 21, 2017, 02:32:40 pm
Facesitting Bitches - Smothered Slave

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/W/4gDWW/Facesitting%20Bitches%20-%20Smothered%20Slave_cover.jpg) (http://pimpandhost.com/image/63072162)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Smothered Slave
Runtime : 31min 21s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/X/4gDX5/Facesitting%20Bitches%20-%20Smothered%20Slave_thumb_0.jpg) (http://pimpandhost.com/image/63072171)

Download Links:

Facesitting Bitches - Smothered Slave.rar (http://k2s.cc/file/63cb183b687a5)
Title: Facesitting Bitches Smothered Soldier
Post by: squidmanheis on April 21, 2017, 05:49:09 pm
Facesitting Bitches - Smothered Soldier

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/Z/4gDZD/Facesitting%20Bitches%20-%20Smothered%20Soldier_cover.jpg) (http://pimpandhost.com/image/63072329)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Smothered Soldier
Runtime : 32min 14s
File Size : 181 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/Z/4gDZL/Facesitting%20Bitches%20-%20Smothered%20Soldier_thumb_0.jpg) (http://pimpandhost.com/image/63072337)

Download Links:

Facesitting Bitches - Smothered Soldier.rar (http://k2s.cc/file/737d027ab0962)
Title: Facesitting Bitches Sniff Them Dry
Post by: squidmanheis on April 21, 2017, 09:05:37 pm
Facesitting Bitches - Sniff Them Dry

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/1/4gE1P/Facesitting%20Bitches%20-%20Sniff%20Them%20Dry_cover.jpg) (http://pimpandhost.com/image/63072465)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Sniff Them Dry
Runtime : 31min 40s
File Size : 177 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/2/4gE26/Facesitting%20Bitches%20-%20Sniff%20Them%20Dry_thumb_0.jpg) (http://pimpandhost.com/image/63072482)

Download Links:

Facesitting Bitches - Sniff Them Dry.rar (http://k2s.cc/file/c6d7faab9f447)
Title: Facesitting Bitches Squash Your Face
Post by: squidmanheis on April 22, 2017, 12:22:07 am
Facesitting Bitches - Squash Your Face

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/4/4gE46/Facesitting%20Bitches%20-%20Squash%20Your%20Face_cover.jpg) (http://pimpandhost.com/image/63072606)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Squash Your Face
Runtime : 32min 28s
File Size : 182 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/4/4gE4a/Facesitting%20Bitches%20-%20Squash%20Your%20Face_thumb_0.jpg) (http://pimpandhost.com/image/63072610)

Download Links:

Facesitting Bitches - Squash Your Face.rar (http://k2s.cc/file/d64c49400b644)
Title: Facesitting Bitches Sudoku Smother
Post by: squidmanheis on April 22, 2017, 03:38:33 am
Facesitting Bitches - Sudoku Smother

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/6/4gE6T/Facesitting%20Bitches%20-%20Sudoku%20Smother_cover.jpg) (http://pimpandhost.com/image/63072779)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Sudoku Smother
Runtime : 31min 58s
File Size : 179 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/6/4gE6V/Facesitting%20Bitches%20-%20Sudoku%20Smother_thumb_0.jpg) (http://pimpandhost.com/image/63072781)

Download Links:

Facesitting Bitches - Sudoku Smother.rar (http://k2s.cc/file/79dcddd9223ad)
Title: Facesitting Bitches Sunshine Smotherbox
Post by: squidmanheis on April 22, 2017, 06:55:08 am
Facesitting Bitches - Sunshine Smotherbox

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/8/4gE8J/Facesitting%20Bitches%20-%20Sunshine%20Smotherbox_cover.jpg) (http://pimpandhost.com/image/63072893)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Sunshine Smotherbox
Runtime : 31min 11s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/8/4gE8R/Facesitting%20Bitches%20-%20Sunshine%20Smotherbox_thumb_0.jpg) (http://pimpandhost.com/image/63072901)

Download Links:

Facesitting Bitches - Sunshine Smotherbox.rar (http://k2s.cc/file/6d300f7eda0eb)
Title: Facesitting Bitches The Agency
Post by: squidmanheis on April 22, 2017, 10:11:40 am
Facesitting Bitches - The Agency

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/b/4gEbi/Facesitting%20Bitches%20-%20The%20Agency_cover.jpg) (http://pimpandhost.com/image/63073052)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Agency
Runtime : 31min 32s
File Size : 177 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/b/4gEbw/Facesitting%20Bitches%20-%20The%20Agency_thumb_0.jpg) (http://pimpandhost.com/image/63073066)

Download Links:

Facesitting Bitches - The Agency.rar (http://k2s.cc/file/04c469c19bfea)
Title: Facesitting Bitches The Art Of Squashing
Post by: squidmanheis on April 22, 2017, 01:27:59 pm
Facesitting Bitches - The Art Of Squashing

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/g/4gEg7/Facesitting%20Bitches%20-%20The%20Art%20Of%20Squashing_cover.jpg) (http://pimpandhost.com/image/63073351)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Art Of Squashing
Runtime : 31min 41s
File Size : 178 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/g/4gEge/Facesitting%20Bitches%20-%20The%20Art%20Of%20Squashing_thumb_0.jpg) (http://pimpandhost.com/image/63073358)

Download Links:

Facesitting Bitches - The Art Of Squashing.rar (http://k2s.cc/file/16ebbb4b6a272)
Title: Facesitting Bitches The Book Worm
Post by: squidmanheis on April 22, 2017, 04:44:31 pm
Facesitting Bitches - The Book Worm

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/i/4gEi9/Facesitting%20Bitches%20-%20The%20Book%20Worm_cover.jpg) (http://pimpandhost.com/image/63073477)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Book Worm
Runtime : 32min 55s
File Size : 184 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/i/4gEib/Facesitting%20Bitches%20-%20The%20Book%20Worm_thumb_0.jpg) (http://pimpandhost.com/image/63073479)

Download Links:

Facesitting Bitches - The Book Worm.rar (http://k2s.cc/file/427d4de387447)
Title: Facesitting Bitches The Cheek Of It
Post by: squidmanheis on April 22, 2017, 08:01:01 pm
Facesitting Bitches - The Cheek Of It

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/k/4gEkV/Facesitting%20Bitches%20-%20The%20Cheek%20Of%20It_cover.jpg) (http://pimpandhost.com/image/63073649)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Cheek Of It
Runtime : 32min 0s
File Size : 179 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/k/4gEkW/Facesitting%20Bitches%20-%20The%20Cheek%20Of%20It_thumb_0.jpg) (http://pimpandhost.com/image/63073650)

Download Links:

Facesitting Bitches - The Cheek Of It.rar (http://k2s.cc/file/27a64a5a3a402)
Title: Facesitting Bitches The Hitchhiker Returns
Post by: squidmanheis on April 22, 2017, 11:17:22 pm
Facesitting Bitches - The Hitchhiker Returns

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/m/4gEmM/Facesitting%20Bitches%20-%20The%20Hitchhiker%20Returns_cover.jpg) (http://pimpandhost.com/image/63073764)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Hitchhiker Returns
Runtime : 31min 53s
File Size : 179 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/m/4gEmO/Facesitting%20Bitches%20-%20The%20Hitchhiker%20Returns_thumb_0.jpg) (http://pimpandhost.com/image/63073766)

Download Links:

Facesitting Bitches - The Hitchhiker Returns.rar (http://k2s.cc/file/59d2bf8d6b2d3)
Title: Facesitting Bitches The Landlady
Post by: squidmanheis on April 23, 2017, 02:33:46 am
Facesitting Bitches - The Landlady

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/p/4gEpi/Facesitting%20Bitches%20-%20The%20Landlady_cover.jpg) (http://pimpandhost.com/image/63073920)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Landlady
Runtime : 31min 23s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/p/4gEpp/Facesitting%20Bitches%20-%20The%20Landlady_thumb_0.jpg) (http://pimpandhost.com/image/63073927)

Download Links:

Facesitting Bitches - The Landlady.rar (http://k2s.cc/file/25b43183c2143)
Title: Facesitting Bitches The Salesman
Post by: squidmanheis on April 23, 2017, 05:50:14 am
Facesitting Bitches - The Salesman


Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Salesman
Runtime : 31min 42s
File Size : 178 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/r/4gErf/Facesitting%20Bitches%20-%20The%20Salesman_thumb_0.jpg) (http://pimpandhost.com/image/63074041)

Download Links:

Facesitting Bitches - The Salesman.rar (http://k2s.cc/file/1583acbc4d771)
Title: Facesitting Bitches The Worm Has Turned
Post by: squidmanheis on April 23, 2017, 09:06:45 am
Facesitting Bitches - The Worm Has Turned

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/s/4gEs1/Facesitting%20Bitches%20-%20The%20Worm%20Has%20Turned_cover.jpg) (http://pimpandhost.com/image/63074089)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - The Worm Has Turned
Runtime : 31min 29s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/s/4gEs3/Facesitting%20Bitches%20-%20The%20Worm%20Has%20Turned_thumb_0.jpg) (http://pimpandhost.com/image/63074091)

Download Links:

Facesitting Bitches - The Worm Has Turned.rar (http://k2s.cc/file/200fd1152551f)
Title: Facesitting Bitches Tight Arse
Post by: squidmanheis on April 23, 2017, 12:23:21 pm
Facesitting Bitches - Tight Arse

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/s/4gEsK/Facesitting%20Bitches%20-%20Tight%20Arse_cover.jpg) (http://pimpandhost.com/image/63074134)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Tight Arse
Runtime : 31min 17s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/s/4gEsL/Facesitting%20Bitches%20-%20Tight%20Arse_thumb_0.jpg) (http://pimpandhost.com/image/63074135)

Download Links:

Facesitting Bitches - Tight Arse.rar (http://k2s.cc/file/4e5bde7fed4bc)
Title: Facesitting Bitches Toy Boy
Post by: squidmanheis on April 23, 2017, 03:39:49 pm
Facesitting Bitches - Toy Boy

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/t/4gEts/Facesitting%20Bitches%20-%20Toy%20Boy_cover.jpg) (http://pimpandhost.com/image/63074178)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Toy Boy
Runtime : 32min 11s
File Size : 180 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/t/4gEtu/Facesitting%20Bitches%20-%20Toy%20Boy_thumb_0.jpg) (http://pimpandhost.com/image/63074180)

Download Links:

Facesitting Bitches - Toy Boy.rar (http://k2s.cc/file/cf35383594943)
Title: Facesitting Bitches Trapped
Post by: squidmanheis on April 23, 2017, 06:56:07 pm
Facesitting Bitches - Trapped

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/u/4gEuv/Facesitting%20Bitches%20-%20Trapped_cover.jpg) (http://pimpandhost.com/image/63074243)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Trapped
Runtime : 32min 34s
File Size : 182 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/u/4gEuw/Facesitting%20Bitches%20-%20Trapped_thumb_0.jpg) (http://pimpandhost.com/image/63074244)

Download Links:

Facesitting Bitches - Trapped.rar (http://k2s.cc/file/3b506b3aa6c01)
Title: Facesitting Bitches Trouble Breathing
Post by: squidmanheis on April 23, 2017, 10:12:33 pm
Facesitting Bitches - Trouble Breathing

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/v/4gEvi/Facesitting%20Bitches%20-%20Trouble%20Breathing_cover.jpg) (http://pimpandhost.com/image/63074292)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Trouble Breathing
Runtime : 31min 21s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/v/4gEvk/Facesitting%20Bitches%20-%20Trouble%20Breathing_thumb_0.jpg) (http://pimpandhost.com/image/63074294)

Download Links:

Facesitting Bitches - Trouble Breathing.rar (http://k2s.cc/file/f5edb66a526b0)
Title: Facesitting Bitches Two in the Bush
Post by: squidmanheis on April 24, 2017, 01:28:57 am
Facesitting Bitches - Two in the Bush

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/v/4gEvT/Facesitting%20Bitches%20-%20Two%20in%20the%20Bush_cover.jpg) (http://pimpandhost.com/image/63074329)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Two in the Bush
Runtime : 31min 43s
File Size : 178 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/v/4gEvX/Facesitting%20Bitches%20-%20Two%20in%20the%20Bush_thumb_0.jpg) (http://pimpandhost.com/image/63074333)

Download Links:

Facesitting Bitches - Two in the Bush.rar (http://k2s.cc/file/6524c30436329)
Title: Facesitting Bitches Up Her Skirt
Post by: squidmanheis on April 24, 2017, 04:45:29 am
Facesitting Bitches - Up Her Skirt

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/y/4gEy8/Facesitting%20Bitches%20-%20Up%20Her%20Skirt_cover.jpg) (http://pimpandhost.com/image/63074468)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Up Her Skirt
Runtime : 31min 49s
File Size : 178 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/y/4gEyc/Facesitting%20Bitches%20-%20Up%20Her%20Skirt_thumb_0.jpg) (http://pimpandhost.com/image/63074472)

Download Links:

Facesitting Bitches - Up Her Skirt.rar (http://k2s.cc/file/b5307ed8927de)
Title: Facesitting Bitches Using His Face
Post by: squidmanheis on April 24, 2017, 08:01:59 am
Facesitting Bitches - Using His Face

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/z/4gEzz/Facesitting%20Bitches%20-%20Using%20His%20Face_cover.jpg) (http://pimpandhost.com/image/63074557)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Using His Face
Runtime : 31min 28s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/z/4gEzB/Facesitting%20Bitches%20-%20Using%20His%20Face_thumb_0.jpg) (http://pimpandhost.com/image/63074559)

Download Links:

Facesitting Bitches - Using His Face.rar (http://k2s.cc/file/f4414ef500703)
Title: Facesitting Bitches Wide Load
Post by: squidmanheis on April 24, 2017, 11:18:22 am
Facesitting Bitches - Wide Load

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/A/4gEAs/Facesitting%20Bitches%20-%20Wide%20Load_cover.jpg) (http://pimpandhost.com/image/63074612)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - Wide Load
Runtime : 32min 52s
File Size : 184 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/A/4gEAt/Facesitting%20Bitches%20-%20Wide%20Load_thumb_0.jpg) (http://pimpandhost.com/image/63074613)

Download Links:

Facesitting Bitches - Wide Load.rar (http://k2s.cc/file/540bd26e2c80b)
Title: Facesitting Bitches You Were Warned
Post by: squidmanheis on April 24, 2017, 02:34:52 pm
Facesitting Bitches - You Were Warned

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/B/4gEBl/Facesitting%20Bitches%20-%20You%20Were%20Warned_cover.jpg) (http://pimpandhost.com/image/63074667)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Bitches - You Were Warned
Runtime : 32min 43s
File Size : 183 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/B/4gEBm/Facesitting%20Bitches%20-%20You%20Were%20Warned_thumb_0.jpg) (http://pimpandhost.com/image/63074668)

Download Links:

Facesitting Bitches - You Were Warned.rar (http://k2s.cc/file/8f693b4f368fe)
Title: Facesitting videos 9605402200
Post by: squidmanheis on April 24, 2017, 05:51:04 pm
Facesitting videos 9605402200

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/C/4gECl/Facesitting%20videos%209605402200_cover.jpg) (http://pimpandhost.com/image/63074729)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos 9605402200
Runtime : 4min 39s
File Size : 71.3 MB
File Type: asf
Resolution : 960x540

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/C/4gECn/Facesitting%20videos%209605402200_thumb_0.jpg) (http://pimpandhost.com/image/63074731)

Download Links:

Facesitting videos 9605402200.rar (http://k2s.cc/file/7af8055c20259)
Title: Facesitting videos 9605402200Pt1
Post by: squidmanheis on April 24, 2017, 09:08:05 pm
Facesitting videos 9605402200Pt1

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/C/4gECC/Facesitting%20videos%209605402200Pt1_cover.jpg) (http://pimpandhost.com/image/63074746)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos 9605402200Pt1
Runtime : 5min 58s
File Size : 91.1 MB
File Type: asf
Resolution : 960x540

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/C/4gECD/Facesitting%20videos%209605402200Pt1_thumb_0.jpg) (http://pimpandhost.com/image/63074747)

Download Links:

Facesitting videos 9605402200Pt1.rar (http://k2s.cc/file/02477407a7363)
Title: Facesitting videos A nerdy fan eats Mia Khalifas sweet Lebanese
Post by: squidmanheis on April 25, 2017, 12:24:16 am
Facesitting videos A nerdy fan eats Mia Khalifas sweet Lebanese

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/C/4gECO/Facesitting%20videos%20A%20nerdy%20fan%20eats%20Mia%20Khalifas%20sweet%20Lebanese_cover.jpg) (http://pimpandhost.com/image/63074758)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos A nerdy fan eats Mia Khalifas sweet Lebanese
Runtime : 2min 33s
File Size : 38.3 MB
File Type: flv
Resolution : 1280x682

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/C/4gECP/Facesitting%20videos%20A%20nerdy%20fan%20eats%20Mia%20Khalifas%20sweet%20Lebanese_thumb_0.jpg) (http://pimpandhost.com/image/63074759)

Download Links:

Facesitting videos A nerdy fan eats Mia Khalifas sweet Lebanese.rar (http://k2s.cc/file/42ed8c8c86d75)
Title: Facesitting videos alexiscuckoldbitch1
Post by: squidmanheis on April 25, 2017, 03:40:36 am
Facesitting videos alexiscuckoldbitch1

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/D/4gED3/Facesitting%20videos%20alexiscuckoldbitch1_cover.jpg) (http://pimpandhost.com/image/63074773)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos alexiscuckoldbitch1
Runtime : 5min 44s
File Size : 89.1 MB
File Type: wmv
Resolution : 960x540

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/D/4gED5/Facesitting%20videos%20alexiscuckoldbitch1_thumb_0.jpg) (http://pimpandhost.com/image/63074775)

Download Links:

Facesitting videos alexiscuckoldbitch1.rar (http://k2s.cc/file/6770adf5bee77)
Title: Facesitting videos Between her cheeks
Post by: squidmanheis on April 25, 2017, 06:57:02 am
Facesitting videos Between her cheeks

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/F/4gEFg/Facesitting%20videos%20Between%20her%20cheeks_cover.jpg) (http://pimpandhost.com/image/63074910)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Between her cheeks
Runtime : 6min 39s
File Size : 33.0 MB
File Type: mp4
Resolution : 720x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/F/4gEFr/Facesitting%20videos%20Between%20her%20cheeks_thumb_0.jpg) (http://pimpandhost.com/image/63074921)

Download Links:

Facesitting videos Between her cheeks.rar (http://k2s.cc/file/e6929e1172ea8)
Title: Facesitting videos blondgwp8 1
Post by: squidmanheis on April 25, 2017, 10:13:20 am
Facesitting videos blondgwp8-1

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/G/4gEGa/Facesitting%20videos%20blondgwp8-1_cover.jpg) (http://pimpandhost.com/image/63074966)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos blondgwp8-1
Runtime : 5min 17s
File Size : 38.0 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/G/4gEGf/Facesitting%20videos%20blondgwp8-1_thumb_0.jpg) (http://pimpandhost.com/image/63074971)

Download Links:

Facesitting videos blondgwp8-1.rar (http://k2s.cc/file/5c5a13f3c477b)
Title: Facesitting videos boss getting her ass licked in heels
Post by: squidmanheis on April 25, 2017, 01:29:49 pm
Facesitting videos boss getting her ass licked in heels

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/G/4gEGD/Facesitting%20videos%20boss%20getting%20her%20ass%20licked%20in%20heels_cover.jpg) (http://pimpandhost.com/image/63074995)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos boss getting her ass licked in heels
Runtime : 7min 6s
File Size : 113 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/G/4gEGG/Facesitting%20videos%20boss%20getting%20her%20ass%20licked%20in%20heels_thumb_0.jpg) (http://pimpandhost.com/image/63074998)

Download Links:

Facesitting videos boss getting her ass licked in heels.rar (http://k2s.cc/file/789ab91c2d088)
Title: Facesitting videos cl 1475
Post by: squidmanheis on April 25, 2017, 04:46:16 pm
Facesitting videos cl 1475

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/I/4gEIF/Facesitting%20videos%20cl%201475_cover.jpg) (http://pimpandhost.com/image/63075121)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos cl 1475
Runtime : 6min 21s
File Size : 79.1 MB
File Type: wmv
Resolution : 1024x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/I/4gEIN/Facesitting%20videos%20cl%201475_thumb_0.jpg) (http://pimpandhost.com/image/63075129)

Download Links:

Facesitting videos cl 1475.rar (http://k2s.cc/file/a9a9dd38f1f84)
Title: Facesitting videos cl 185
Post by: squidmanheis on April 25, 2017, 08:03:49 pm
Facesitting videos cl 185


Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos cl 185
Runtime : 5min 40s
File Size : 65.2 MB
File Type: wmv
Resolution : 1024x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/L/4gELr/Facesitting%20videos%20cl%20185_thumb_0.jpg) (http://pimpandhost.com/image/63075293)

Download Links:

Facesitting videos cl 185.rar (http://k2s.cc/file/b1c191641c629)
Title: Facesitting videos cl 90
Post by: squidmanheis on April 25, 2017, 11:20:25 pm
Facesitting videos cl 90

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/N/4gENE/Facesitting%20videos%20cl%2090_cover.jpg) (http://pimpandhost.com/image/63075430)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos cl 90
Runtime : 8min 8s
File Size : 75.2 MB
File Type: wmv
Resolution : 1024x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/N/4gENL/Facesitting%20videos%20cl%2090_thumb_0.jpg) (http://pimpandhost.com/image/63075437)

Download Links:

Facesitting videos cl 90.rar (http://k2s.cc/file/a1983de9672bb)
Title: Facesitting videos Claires Feet Sniffing After Dancing All Night
Post by: squidmanheis on April 26, 2017, 02:36:25 am
Facesitting videos Claires Feet Sniffing After Dancing All Night

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/Q/4gEQ9/Facesitting%20videos%20Claires%20Feet%20Sniffing%20After%20Dancing%20All%20Night_cover.jpg) (http://pimpandhost.com/image/63075585)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Claires Feet Sniffing After Dancing All Night
Runtime : 5min 25s
File Size : 84.2 MB
File Type: asf
Resolution : 960x540

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/Q/4gEQx/Facesitting%20videos%20Claires%20Feet%20Sniffing%20After%20Dancing%20All%20Night_thumb_0.jpg) (http://pimpandhost.com/image/63075609)

Download Links:

Facesitting videos Claires Feet Sniffing After Dancing All Night.rar (http://k2s.cc/file/d6459765c013d)
Title: Facesitting videos clip218 Small dick eat pussy
Post by: squidmanheis on April 26, 2017, 05:52:43 am
Facesitting videos clip218 Small dick eat pussy

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/T/4gET1/Facesitting%20videos%20clip218%20Small%20dick%20eat%20pussy_cover.jpg) (http://pimpandhost.com/image/63075763)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos clip218 Small dick eat pussy
Runtime : 4min 15s
File Size : 65.0 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/T/4gET3/Facesitting%20videos%20clip218%20Small%20dick%20eat%20pussy_thumb_0.jpg) (http://pimpandhost.com/image/63075765)

Download Links:

Facesitting videos clip218 Small dick eat pussy.rar (http://k2s.cc/file/b666bcff259e8)
Title: Facesitting videos dom girls facesit 9
Post by: squidmanheis on April 26, 2017, 09:09:13 am
Facesitting videos dom girls facesit 9

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/V/4gEVd/Facesitting%20videos%20dom%20girls%20facesit%209_cover.jpg) (http://pimpandhost.com/image/63075899)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos dom girls facesit 9
Runtime : 4min 7s
File Size : 29.6 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/V/4gEVj/Facesitting%20videos%20dom%20girls%20facesit%209_thumb_0.jpg) (http://pimpandhost.com/image/63075905)

Download Links:

Facesitting videos dom girls facesit 9.rar (http://k2s.cc/file/e81f40874acb4)
Title: Facesitting videos DT639
Post by: squidmanheis on April 26, 2017, 02:14:33 pm
Facesitting videos DT639

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/W/4gEWE/Facesitting%20videos%20DT639_cover.jpg) (http://pimpandhost.com/image/63075988)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos DT639
Runtime : 8min 38s
File Size : 76.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/W/4gEWJ/Facesitting%20videos%20DT639_thumb_0.jpg) (http://pimpandhost.com/image/63075993)

Download Links:

Facesitting videos DT639.rar (http://k2s.cc/file/76c1b9af0edb6)
Title: Facesitting videos Face fucked with her hairy pussy
Post by: squidmanheis on April 26, 2017, 03:42:14 pm
Facesitting videos Face fucked with her hairy pussy

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/Z/4gEZ3/Facesitting%20videos%20Face%20fucked%20with%20her%20hairy%20pussy_cover.jpg) (http://pimpandhost.com/image/63076137)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Face fucked with her hairy pussy
Runtime : 6min 14s
File Size : 76.2 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/Z/4gEZ6/Facesitting%20videos%20Face%20fucked%20with%20her%20hairy%20pussy_thumb_0.jpg) (http://pimpandhost.com/image/63076140)

Download Links:

Facesitting videos Face fucked with her hairy pussy.rar (http://k2s.cc/file/dcd87ba59af03)
Title: Facesitting videos fart Melody Nakai 6
Post by: squidmanheis on April 26, 2017, 06:58:42 pm
Facesitting videos fart Melody Nakai 6

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/Z/4gEZW/Facesitting%20videos%20fart%20Melody%20Nakai%206_cover.jpg) (http://pimpandhost.com/image/63076192)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos fart Melody Nakai 6
Runtime : 9min 30s
File Size : 74.3 MB
File Type: mp4
Resolution : 852x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/0/4gF01/Facesitting%20videos%20fart%20Melody%20Nakai%206_thumb_0.jpg) (http://pimpandhost.com/image/63076197)

Download Links:

Facesitting videos fart Melody Nakai 6.rar (http://k2s.cc/file/0d2f92a7bf69d)
Title: Facesitting videos FSFAR CHAIR K
Post by: squidmanheis on April 26, 2017, 10:15:09 pm
Facesitting videos FSFAR CHAIR  K

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/1/4gF19/Facesitting%20videos%20FSFAR%20CHAIR%20%20K_cover.jpg) (http://pimpandhost.com/image/63076267)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos FSFAR CHAIR  K
Runtime : 2min 48s
File Size : 38.9 MB
File Type: wmv
Resolution : 852x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/1/4gF1b/Facesitting%20videos%20FSFAR%20CHAIR%20%20K_thumb_0.jpg) (http://pimpandhost.com/image/63076269)

Download Links:

Facesitting videos FSFAR CHAIR  K.rar (http://k2s.cc/file/0e438c57a2351)
Title: Facesitting videos Gorgeous ass of mistress
Post by: squidmanheis on April 27, 2017, 01:31:38 am
Facesitting videos Gorgeous ass of mistress

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/1/4gF1J/Facesitting%20videos%20Gorgeous%20ass%20of%20mistress_cover.jpg) (http://pimpandhost.com/image/63076303)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Gorgeous ass of mistress
Runtime : 11min 12s
File Size : 31.0 MB
File Type: mp4
Resolution : 768x432

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/1/4gF1R/Facesitting%20videos%20Gorgeous%20ass%20of%20mistress_thumb_0.jpg) (http://pimpandhost.com/image/63076311)

Download Links:

Facesitting videos Gorgeous ass of mistress.rar (http://k2s.cc/file/5ddb0fbdf29b5)
Title: Facesitting videos Hairy babe facesitting Pornhub com
Post by: squidmanheis on April 27, 2017, 04:47:43 am
Facesitting videos Hairy babe facesitting - Pornhub com

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/2/4gF2i/Facesitting%20videos%20Hairy%20babe%20facesitting%20-%20Pornhub.com_cover.jpg) (http://pimpandhost.com/image/63076338)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Hairy babe facesitting - Pornhub.com
Runtime : 2min 45s
File Size : 14.2 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/2/4gF2k/Facesitting%20videos%20Hairy%20babe%20facesitting%20-%20Pornhub.com_thumb_0.jpg) (http://pimpandhost.com/image/63076340)

Download Links:

Facesitting videos Hairy babe facesitting - Pornhub.com.rar (http://k2s.cc/file/80c5e32a7cda2)
Title: Facesitting videos hot girl fs fs victim
Post by: squidmanheis on April 27, 2017, 08:04:14 am
Facesitting videos hot girl fs fs victim

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/2/4gF2s/Facesitting%20videos%20hot%20girl%20fs%20fs%20victim_cover.jpg) (http://pimpandhost.com/image/63076348)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos hot girl fs fs victim
Runtime : 11min 51s
File Size : 67.6 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/2/4gF2z/Facesitting%20videos%20hot%20girl%20fs%20fs%20victim_thumb_0.jpg) (http://pimpandhost.com/image/63076355)

Download Links:

Facesitting videos hot girl fs fs victim.rar (http://k2s.cc/file/748d75f64e00f)
Title: Facesitting videos Jas ve friend as worsship
Post by: squidmanheis on April 27, 2017, 11:20:41 am
Facesitting videos Jas ve friend as worsship

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/3/4gF3A/Facesitting%20videos%20Jas%20ve%20friend%20as%20worsship_cover.jpg) (http://pimpandhost.com/image/63076418)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Jas ve friend as worsship
Runtime : 4min 55s
File Size : 68.1 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/3/4gF3F/Facesitting%20videos%20Jas%20ve%20friend%20as%20worsship_thumb_0.jpg) (http://pimpandhost.com/image/63076423)

Download Links:

Facesitting videos Jas ve friend as worsship.rar (http://k2s.cc/file/7803960a57f6d)
Title: Facesitting videos Jsmine Mendez as worship
Post by: squidmanheis on April 27, 2017, 02:37:05 pm
Facesitting videos Jsmine Mendez as worship

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/4/4gF4s/Facesitting%20videos%20Jsmine%20Mendez%20as%20worship_cover.jpg) (http://pimpandhost.com/image/63076472)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Jsmine Mendez as worship
Runtime : 6min 44s
File Size : 92.1 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/4/4gF4v/Facesitting%20videos%20Jsmine%20Mendez%20as%20worship_thumb_0.jpg) (http://pimpandhost.com/image/63076475)

Download Links:

Facesitting videos Jsmine Mendez as worship.rar (http://k2s.cc/file/c5d462f6a9a6e)
Title: Facesitting videos Kamasutra teaching you how to cunnilingus PornDoe
Post by: squidmanheis on April 27, 2017, 05:53:37 pm
Facesitting videos Kamasutra teaching you how to cunnilingus - PornDoe

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/5/4gF5P/Facesitting%20videos%20Kamasutra%20teaching%20you%20how%20to%20cunnilingus%20-%20PornDoe_cover.jpg) (http://pimpandhost.com/image/63076557)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Kamasutra teaching you how to cunnilingus - PornDoe
Runtime : 6min 41s
File Size : 24.2 MB
File Type: mp4
Resolution : 638x358

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/5/4gF5Q/Facesitting%20videos%20Kamasutra%20teaching%20you%20how%20to%20cunnilingus%20-%20PornDoe_thumb_0.jpg) (http://pimpandhost.com/image/63076558)

Download Links:

Facesitting videos Kamasutra teaching you how to cunnilingus - PornDoe.rar (http://k2s.cc/file/12be8e0f9552f)
Title: Facesitting videos Latina babe Danira Love gets her delicious bush
Post by: squidmanheis on April 27, 2017, 09:10:08 pm
Facesitting videos Latina babe Danira Love gets her delicious bush

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/6/4gF6o/Facesitting%20videos%20Latina%20babe%20Danira%20Love%20gets%20her%20delicious%20bush_cover.jpg) (http://pimpandhost.com/image/63076592)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Latina babe Danira Love gets her delicious bush
Runtime : 3min 41s
File Size : 35.9 MB
File Type: mp4
Resolution : 852x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/6/4gF6q/Facesitting%20videos%20Latina%20babe%20Danira%20Love%20gets%20her%20delicious%20bush_thumb_0.jpg) (http://pimpandhost.com/image/63076594)

Download Links:

Facesitting videos Latina babe Danira Love gets her delicious bush.rar (http://k2s.cc/file/bf0e480b7bea7)
Title: Facesitting videos Licking Eris after she was on toilet Femdom Vip
Post by: squidmanheis on April 28, 2017, 12:26:36 am
Facesitting videos Licking Eris after she was on toilet - Femdom Vip

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/7/4gF72/Facesitting%20videos%20Licking%20Eris%20after%20she%20was%20on%20toilet%20-%20Femdom%20Vip_cover.jpg) (http://pimpandhost.com/image/63076632)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Licking Eris after she was on toilet - Femdom Vip
Runtime : 4min 53s
File Size : 19.7 MB
File Type: mp4
Resolution : 852x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/7/4gF78/Facesitting%20videos%20Licking%20Eris%20after%20she%20was%20on%20toilet%20-%20Femdom%20Vip_thumb_0.jpg) (http://pimpandhost.com/image/63076638)

Download Links:

Facesitting videos Licking Eris after she was on toilet - Femdom Vip.rar (http://k2s.cc/file/91bdb734ed0ee)
Title: Facesitting videos Malina Lay Erziehung zum Lecksklave
Post by: squidmanheis on April 28, 2017, 03:43:05 am
Facesitting videos Malina Lay Erziehung zum Lecksklave

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/7/4gF7n/Facesitting%20videos%20Malina%20Lay%20Erziehung%20zum%20Lecksklave_cover.jpg) (http://pimpandhost.com/image/63076653)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Malina Lay Erziehung zum Lecksklave
Runtime : 3min 57s
File Size : 81.4 MB
File Type: flv
Resolution : 1920x1080

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/7/4gF7p/Facesitting%20videos%20Malina%20Lay%20Erziehung%20zum%20Lecksklave_thumb_0.jpg) (http://pimpandhost.com/image/63076655)

Download Links:

Facesitting videos Malina Lay Erziehung zum Lecksklave.rar (http://k2s.cc/file/0d213aef1534e)
Title: Facesitting videos Masorotica Face Bouncer 4
Post by: squidmanheis on April 28, 2017, 06:59:29 am
Facesitting videos Masorotica - Face Bouncer 4

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/8/4gF8c/Facesitting%20videos%20Masorotica%20-%20Face%20Bouncer%204_cover.jpg) (http://pimpandhost.com/image/63076704)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Masorotica - Face Bouncer 4
Runtime : 3min 39s
File Size : 39.6 MB
File Type: wmv
Resolution : 720x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/8/4gF8i/Facesitting%20videos%20Masorotica%20-%20Face%20Bouncer%204_thumb_0.jpg) (http://pimpandhost.com/image/63076710)

Download Links:

Facesitting videos Masorotica - Face Bouncer 4.rar (http://k2s.cc/file/575083814ed25)
Title: Facesitting videos Movie0892CFS Pussy licking 101 Jaelynn
Post by: squidmanheis on April 28, 2017, 10:15:52 am
Facesitting videos Movie0892CFS - Pussy licking 101 Jaelynn

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/9/4gF92/Facesitting%20videos%20Movie0892CFS%20-%20Pussy%20licking%20101%20Jaelynn_cover.jpg) (http://pimpandhost.com/image/63076756)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Movie0892CFS - Pussy licking 101 Jaelynn
Runtime : 7min 31s
File Size : 85.7 MB
File Type: wmv
Resolution : 720x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/9/4gF9j/Facesitting%20videos%20Movie0892CFS%20-%20Pussy%20licking%20101%20Jaelynn_thumb_0.jpg) (http://pimpandhost.com/image/63076773)

Download Links:

Facesitting videos Movie0892CFS - Pussy licking 101 Jaelynn.rar (http://k2s.cc/file/769028c1002ca)
Title: Facesitting videos Ms Clara and her old dog
Post by: squidmanheis on April 28, 2017, 01:32:16 pm
Facesitting videos Ms Clara and her old dog

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/a/4gFas/Facesitting%20videos%20Ms%20Clara%20and%20her%20old%20dog_cover.jpg) (http://pimpandhost.com/image/63076844)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Ms Clara and her old dog
Runtime : 11min 2s
File Size : 75.6 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/a/4gFav/Facesitting%20videos%20Ms%20Clara%20and%20her%20old%20dog_thumb_0.jpg) (http://pimpandhost.com/image/63076847)

Download Links:

Facesitting videos Ms Clara and her old dog.rar (http://k2s.cc/file/68dc26d23f9e4)
Title: Facesitting videos ok fb ss703 01
Post by: squidmanheis on April 28, 2017, 04:48:42 pm
Facesitting videos ok fb ss703 01

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/b/4gFbn/Facesitting%20videos%20ok%20fb%20ss703%2001_cover.jpg) (http://pimpandhost.com/image/63076901)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos ok fb ss703 01
Runtime : 9min 34s
File Size : 72.7 MB
File Type: wmv
Resolution : 640x360

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/b/4gFbw/Facesitting%20videos%20ok%20fb%20ss703%2001_thumb_0.jpg) (http://pimpandhost.com/image/63076910)

Download Links:

Facesitting videos ok fb ss703 01.rar (http://k2s.cc/file/0c3939f2edd55)
Title: Facesitting videos piss on the bed blonde girl
Post by: squidmanheis on April 28, 2017, 08:05:06 pm
Facesitting videos piss on the bed blonde girl

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/c/4gFcW/Facesitting%20videos%20piss%20on%20the%20bed%20blonde%20girl_cover.jpg) (http://pimpandhost.com/image/63076998)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos piss on the bed blonde girl
Runtime : 5min 8s
File Size : 38.7 MB
File Type: mp4
Resolution : 854x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/d/4gFd0/Facesitting%20videos%20piss%20on%20the%20bed%20blonde%20girl_thumb_0.jpg) (http://pimpandhost.com/image/63077002)

Download Links:

Facesitting videos piss on the bed blonde girl.rar (http://k2s.cc/file/94bc8582871da)
Title: Facesitting videos Russ fel Kat 05 fb
Post by: squidmanheis on April 28, 2017, 11:21:33 pm
Facesitting videos Russ fel Kat 05 fb

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/d/4gFdx/Facesitting%20videos%20Russ%20fel%20Kat%2005%20fb_cover.jpg) (http://pimpandhost.com/image/63077035)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Russ fel Kat 05 fb
Runtime : 2min 26s
File Size : 9.64 MB
File Type: mp4
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/d/4gFdG/Facesitting%20videos%20Russ%20fel%20Kat%2005%20fb_thumb_0.jpg) (http://pimpandhost.com/image/63077044)

Download Links:

Facesitting videos Russ fel Kat 05 fb.rar (http://k2s.cc/file/4e3c07c59210a)
Title: Facesitting videos Russian facesitting and footworship
Post by: squidmanheis on April 29, 2017, 02:37:56 am
Facesitting videos Russian facesitting and footworship

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/e/4gFe1/Facesitting%20videos%20Russian%20facesitting%20and%20footworship_cover.jpg) (http://pimpandhost.com/image/63077065)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Russian facesitting and footworship
Runtime : 4min 46s
File Size : 72.2 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/e/4gFe3/Facesitting%20videos%20Russian%20facesitting%20and%20footworship_thumb_0.jpg) (http://pimpandhost.com/image/63077067)

Download Links:

Facesitting videos Russian facesitting and footworship.rar (http://k2s.cc/file/90bce05b18c11)
Title: Facesitting videos Sorry your hurt but you still have to clean my ass
Post by: squidmanheis on April 29, 2017, 05:54:21 am
Facesitting videos Sorry your hurt but you still have to clean my ass

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/f/4gFfc/Facesitting%20videos%20Sorry%20your%20hurt%20but%20you%20still%20have%20to%20clean%20my%20ass_cover.jpg) (http://pimpandhost.com/image/63077138)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos Sorry your hurt but you still have to clean my ass
Runtime : 11min 3s
File Size : 118 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/f/4gFfi/Facesitting%20videos%20Sorry%20your%20hurt%20but%20you%20still%20have%20to%20clean%20my%20ass_thumb_0.jpg) (http://pimpandhost.com/image/63077144)

Download Links:

Facesitting videos Sorry your hurt but you still have to clean my ass.rar (http://k2s.cc/file/b8428813b4fa4)
Title: Facesitting videos washp
Post by: squidmanheis on April 29, 2017, 09:10:57 am
Facesitting videos washp

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/i/4gFiD/Facesitting%20videos%20washp_cover.jpg) (http://pimpandhost.com/image/63077351)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting videos washp
Runtime : 1min 38s
File Size : 19.4 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/i/4gFiL/Facesitting%20videos%20washp_thumb_0.jpg) (http://pimpandhost.com/image/63077359)

Download Links:

Facesitting videos washp.rar (http://k2s.cc/file/c824e887b2ee4)
Title: Hottestfacesitting 01 Mistress Nastya
Post by: squidmanheis on April 29, 2017, 12:27:17 pm
Hottestfacesitting 01 Mistress Nastya

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/j/4gFjh/Hottestfacesitting%2001%20Mistress%20Nastya%20_cover.jpg) (http://pimpandhost.com/image/63077391)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 01 Mistress Nastya
Runtime : 11min 46s
File Size : 113 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/j/4gFjn/Hottestfacesitting%2001%20Mistress%20Nastya%20_thumb_0.jpg) (http://pimpandhost.com/image/63077397)

Download Links:

Hottestfacesitting 01 Mistress Nastya .rar (http://k2s.cc/file/00f19c9471827)
Title: Hottestfacesitting 010 Mistress Mariana
Post by: squidmanheis on April 29, 2017, 03:43:43 pm
Hottestfacesitting 010 Mistress Mariana

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/k/4gFkG/Hottestfacesitting%20010%20Mistress%20Mariana%20_cover.jpg) (http://pimpandhost.com/image/63077478)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 010 Mistress Mariana
Runtime : 15min 43s
File Size : 147 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/k/4gFkK/Hottestfacesitting%20010%20Mistress%20Mariana%20_thumb_0.jpg) (http://pimpandhost.com/image/63077482)

Download Links:

Hottestfacesitting 010 Mistress Mariana .rar (http://k2s.cc/file/16f869c37bda5)
Title: Hottestfacesitting 011 Mistress Olga
Post by: squidmanheis on April 29, 2017, 07:00:18 pm
Hottestfacesitting 011 Mistress Olga

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/o/4gFo5/Hottestfacesitting%20011%20Mistress%20Olga%20_cover.jpg) (http://pimpandhost.com/image/63077689)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 011 Mistress Olga
Runtime : 18min 31s
File Size : 173 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/o/4gFob/Hottestfacesitting%20011%20Mistress%20Olga%20_thumb_0.jpg) (http://pimpandhost.com/image/63077695)

Download Links:

Hottestfacesitting 011 Mistress Olga .rar (http://k2s.cc/file/b8708973377f4)
Title: Hottestfacesitting 012 Mistress Liza
Post by: squidmanheis on April 29, 2017, 10:16:43 pm
Hottestfacesitting 012 Mistress Liza

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/u/4gFub/Hottestfacesitting%20012%20Mistress%20Liza%20_cover.jpg) (http://pimpandhost.com/image/63078067)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 012 Mistress Liza
Runtime : 17min 20s
File Size : 162 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/u/4gFui/Hottestfacesitting%20012%20Mistress%20Liza%20_thumb_0.jpg) (http://pimpandhost.com/image/63078074)

Download Links:

Hottestfacesitting 012 Mistress Liza .rar (http://k2s.cc/file/cabffa1c7d8ce)
Title: Hottestfacesitting 013 Oksana Marika
Post by: squidmanheis on April 30, 2017, 01:33:16 am
Hottestfacesitting 013 Oksana  Marika

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/v/4gFvB/Hottestfacesitting%20013%20Oksana%20%20Marika%20_cover.jpg) (http://pimpandhost.com/image/63078155)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 013 Oksana  Marika
Runtime : 14min 4s
File Size : 131 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/v/4gFvH/Hottestfacesitting%20013%20Oksana%20%20Marika%20_thumb_0.jpg) (http://pimpandhost.com/image/63078161)

Download Links:

Hottestfacesitting 013 Oksana  Marika .rar (http://k2s.cc/file/0fd74f2f52408)
Title: Hottestfacesitting 014 Mistress Katya and Mistress Julia
Post by: squidmanheis on April 30, 2017, 04:49:46 am
Hottestfacesitting 014 Mistress Katya and Mistress Julia

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/A/4gFA1/Hottestfacesitting%20014%20Mistress%20Katya%20and%20Mistress%20Julia%20_cover.jpg) (http://pimpandhost.com/image/63078429)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 014 Mistress Katya and Mistress Julia
Runtime : 12min 9s
File Size : 181 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/B/4gFBo/Hottestfacesitting%20014%20Mistress%20Katya%20and%20Mistress%20Julia%20_thumb_0.jpg) (http://pimpandhost.com/image/63078514)

Download Links:

Hottestfacesitting 014 Mistress Katya and Mistress Julia .rar (http://k2s.cc/file/9b3da3f41ad1d)
Title: Hottestfacesitting 015 Mistress Anna
Post by: squidmanheis on April 30, 2017, 08:06:10 am
Hottestfacesitting 015 Mistress Anna

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/N/4gFNZ/Hottestfacesitting%20015%20Mistress%20Anna%20_cover.jpg) (http://pimpandhost.com/image/63079295)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 015 Mistress Anna
Runtime : 12min 58s
File Size : 196 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/O/4gFO1/Hottestfacesitting%20015%20Mistress%20Anna%20_thumb_0.jpg) (http://pimpandhost.com/image/63079297)

Download Links:

Hottestfacesitting 015 Mistress Anna .rar (http://k2s.cc/file/06e66a9c712e3)
Title: Hottestfacesitting 016 Mistress Dasha
Post by: squidmanheis on April 30, 2017, 11:22:30 am
Hottestfacesitting 016 Mistress Dasha

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/U/4gFUx/Hottestfacesitting%20016%20Mistress%20Dasha%20_cover.jpg) (http://pimpandhost.com/image/63079701)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 016 Mistress Dasha
Runtime : 15min 28s
File Size : 233 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/U/4gFUD/Hottestfacesitting%20016%20Mistress%20Dasha%20_thumb_0.jpg) (http://pimpandhost.com/image/63079707)

Download Links:

Hottestfacesitting 016 Mistress Dasha .rar (http://k2s.cc/file/9f84ad1863a1d)
Title: Hottestfacesitting 017 Mistresses Alesya and Annya
Post by: squidmanheis on April 30, 2017, 02:39:14 pm
Hottestfacesitting 017 Mistresses Alesya and Annya

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/X/4gFXx/Hottestfacesitting%20017%20Mistresses%20Alesya%20and%20Annya%20_cover.jpg) (http://pimpandhost.com/image/63079887)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 017 Mistresses Alesya and Annya
Runtime : 18min 15s
File Size : 275 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/X/4gFXD/Hottestfacesitting%20017%20Mistresses%20Alesya%20and%20Annya%20_thumb_0.jpg) (http://pimpandhost.com/image/63079893)

Download Links:

Hottestfacesitting 017 Mistresses Alesya and Annya .rar (http://k2s.cc/file/63b52ddb9d39a)
Title: Hottestfacesitting 018 Mistress Julia and Mistress Dasha
Post by: squidmanheis on April 30, 2017, 05:55:35 pm
Hottestfacesitting 018 Mistress Julia and Mistress Dasha

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/1/4gG1C/Hottestfacesitting%20018%20Mistress%20Julia%20and%20Mistress%20Dasha_cover.jpg) (http://pimpandhost.com/image/63080140)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 018 Mistress Julia and Mistress Dasha
Runtime : 14min 40s
File Size : 169 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/1/4gG1O/Hottestfacesitting%20018%20Mistress%20Julia%20and%20Mistress%20Dasha_thumb_0.jpg) (http://pimpandhost.com/image/63080152)

Download Links:

Hottestfacesitting 018 Mistress Julia and Mistress Dasha.rar (http://k2s.cc/file/7e339050a28a2)
Title: Hottestfacesitting 019 Mistress Julia
Post by: squidmanheis on April 30, 2017, 09:11:50 pm
Hottestfacesitting 019 Mistress Julia

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/4/4gG40/Hottestfacesitting%20019%20Mistress%20Julia_cover.jpg) (http://pimpandhost.com/image/63080288)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 019 Mistress Julia
Runtime : 12min 24s
File Size : 184 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/4/4gG46/Hottestfacesitting%20019%20Mistress%20Julia_thumb_0.jpg) (http://pimpandhost.com/image/63080294)

Download Links:

Hottestfacesitting 019 Mistress Julia.rar (http://k2s.cc/file/a2f893bafcab9)
Title: Hottestfacesitting 02 Mistress Masha
Post by: squidmanheis on May 01, 2017, 12:28:29 am
Hottestfacesitting 02 Mistress Masha

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/c/4gGcD/Hottestfacesitting%2002%20Mistress%20Masha%20_cover.jpg) (http://pimpandhost.com/image/63080823)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 02 Mistress Masha
Runtime : 10min 0s
File Size : 95.9 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/c/4gGcH/Hottestfacesitting%2002%20Mistress%20Masha%20_thumb_0.jpg) (http://pimpandhost.com/image/63080827)

Download Links:

Hottestfacesitting 02 Mistress Masha .rar (http://k2s.cc/file/15d0952f66f7c)
Title: Hottestfacesitting 020 FACESITTING
Post by: squidmanheis on May 01, 2017, 03:44:56 am
Hottestfacesitting 020 FACESITTING

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/f/4gGf4/Hottestfacesitting%20020%20FACESITTING_cover.jpg) (http://pimpandhost.com/image/63080974)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 020 FACESITTING
Runtime : 9min 54s
File Size : 150 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/f/4gGf6/Hottestfacesitting%20020%20FACESITTING_thumb_0.jpg) (http://pimpandhost.com/image/63080976)

Download Links:

Hottestfacesitting 020 FACESITTING.rar (http://k2s.cc/file/aec1e9a54ff11)
Title: Hottestfacesitting 021 Mistress Margarita
Post by: squidmanheis on May 01, 2017, 07:01:37 am
Hottestfacesitting 021 Mistress Margarita

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/g/4gGgP/Hottestfacesitting%20021%20Mistress%20Margarita%20_cover.jpg) (http://pimpandhost.com/image/63081083)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 021 Mistress Margarita
Runtime : 16min 49s
File Size : 255 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/g/4gGgR/Hottestfacesitting%20021%20Mistress%20Margarita%20_thumb_0.jpg) (http://pimpandhost.com/image/63081085)

Download Links:

Hottestfacesitting 021 Mistress Margarita .rar (http://k2s.cc/file/c9832d959c9a3)
Title: Hottestfacesitting 022 Three Young School Bitches
Post by: squidmanheis on May 01, 2017, 10:17:59 am
Hottestfacesitting 022 Three Young School-Bitches

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/j/4gGjW/Hottestfacesitting%20022%20Three%20Young%20School-Bitches%20_cover.jpg) (http://pimpandhost.com/image/63081276)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 022 Three Young School-Bitches
Runtime : 13min 39s
File Size : 203 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/k/4gGk4/Hottestfacesitting%20022%20Three%20Young%20School-Bitches%20_thumb_0.jpg) (http://pimpandhost.com/image/63081284)

Download Links:

Hottestfacesitting 022 Three Young School-Bitches .rar (http://k2s.cc/file/5fa15f2bc6b51)
Title: Hottestfacesitting 023 FACESITTING
Post by: squidmanheis on May 01, 2017, 01:34:34 pm
Hottestfacesitting 023 FACESITTING

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/q/4gGqj/Hottestfacesitting%20023%20FACESITTING%20_cover.jpg) (http://pimpandhost.com/image/63081671)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 023 FACESITTING
Runtime : 14min 44s
File Size : 224 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/q/4gGqA/Hottestfacesitting%20023%20FACESITTING%20_thumb_0.jpg) (http://pimpandhost.com/image/63081688)

Download Links:

Hottestfacesitting 023 FACESITTING .rar (http://k2s.cc/file/89cfa18ba0575)
Title: Hottestfacesitting 024 Goddesses Lera and Dasha
Post by: squidmanheis on May 01, 2017, 04:51:03 pm
Hottestfacesitting 024 Goddesses Lera and Dasha

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/z/4gGzD/Hottestfacesitting%20024%20Goddesses%20Lera%20and%20Dasha_cover.jpg) (http://pimpandhost.com/image/63082249)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 024 Goddesses Lera and Dasha
Runtime : 13min 8s
File Size : 195 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/z/4gGzE/Hottestfacesitting%20024%20Goddesses%20Lera%20and%20Dasha_thumb_0.jpg) (http://pimpandhost.com/image/63082250)

Download Links:

Hottestfacesitting 024 Goddesses Lera and Dasha.rar (http://k2s.cc/file/bd8891018b844)
Title: Hottestfacesitting 025 Goddess Darya
Post by: squidmanheis on May 01, 2017, 08:07:24 pm
Hottestfacesitting 025 Goddess Darya

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/A/4gGAe/Hottestfacesitting%20025%20Goddess%20Darya_cover.jpg) (http://pimpandhost.com/image/63082286)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 025 Goddess Darya
Runtime : 11min 53s
File Size : 177 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/A/4gGAo/Hottestfacesitting%20025%20Goddess%20Darya_thumb_0.jpg) (http://pimpandhost.com/image/63082296)

Download Links:

Hottestfacesitting 025 Goddess Darya.rar (http://k2s.cc/file/230f59e3ccc57)
Title: Hottestfacesitting 026 Goddesses Lana and Julia
Post by: squidmanheis on May 01, 2017, 11:23:48 pm
Hottestfacesitting 026 Goddesses Lana and Julia

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/C/4gGCJ/Hottestfacesitting%20026%20Goddesses%20Lana%20and%20Julia%20_cover.jpg) (http://pimpandhost.com/image/63082441)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 026 Goddesses Lana and Julia
Runtime : 13min 29s
File Size : 200 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/D/4gGD4/Hottestfacesitting%20026%20Goddesses%20Lana%20and%20Julia%20_thumb_0.jpg) (http://pimpandhost.com/image/63082462)

Download Links:

Hottestfacesitting 026 Goddesses Lana and Julia .rar (http://k2s.cc/file/d3cffc0798c38)
Title: Hottestfacesitting 027 Goddesses Alexandra and Dasha
Post by: squidmanheis on May 02, 2017, 02:40:16 am
Hottestfacesitting 027 Goddesses Alexandra and Dasha

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/S/4gGSA/Hottestfacesitting%20027%20Goddesses%20Alexandra%20and%20Dasha%20_cover.jpg) (http://pimpandhost.com/image/63083424)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 027 Goddesses Alexandra and Dasha
Runtime : 12min 34s
File Size : 191 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/G/T/4gGTi/Hottestfacesitting%20027%20Goddesses%20Alexandra%20and%20Dasha%20_thumb_0.jpg) (http://pimpandhost.com/image/63083468)

Download Links:

Hottestfacesitting 027 Goddesses Alexandra and Dasha .rar (http://k2s.cc/file/797ce082d3756)
Title: Hottestfacesitting 028 Two Mistresses and slave
Post by: squidmanheis on May 02, 2017, 05:56:41 am
Hottestfacesitting 028 Two Mistresses and slave

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/H/4/4gH4E/Hottestfacesitting%20028%20Two%20Mistresses%20and%20slave_cover.jpg) (http://pimpandhost.com/image/63084172)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 028 Two Mistresses and slave
Runtime : 12min 53s
File Size : 196 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/H/4/4gH4K/Hottestfacesitting%20028%20Two%20Mistresses%20and%20slave_thumb_0.jpg) (http://pimpandhost.com/image/63084178)

Download Links:

Hottestfacesitting 028 Two Mistresses and slave.rar (http://k2s.cc/file/60497466fe499)
Title: Hottestfacesitting 029 Mistress Olga
Post by: squidmanheis on May 02, 2017, 09:13:03 am
Hottestfacesitting 029 Mistress Olga

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/H/g/4gHgw/Hottestfacesitting%20029%20Mistress%20Olga%20_cover.jpg) (http://pimpandhost.com/image/63084908)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 029 Mistress Olga
Runtime : 13min 24s
File Size : 204 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/H/h/4gHhd/Hottestfacesitting%20029%20Mistress%20Olga%20_thumb_0.jpg) (http://pimpandhost.com/image/63084951)

Download Links:

Hottestfacesitting 029 Mistress Olga .rar (http://k2s.cc/file/85802fd4a0ae6)
Title: Hottestfacesitting 03 Mistress Julya
Post by: squidmanheis on May 02, 2017, 12:29:28 pm
Hottestfacesitting 03 Mistress Julya

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/H/x/4gHxN/Hottestfacesitting%2003%20Mistress%20Julya_cover.jpg) (http://pimpandhost.com/image/63085979)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 03 Mistress Julya
Runtime : 13min 24s
File Size : 128 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/H/x/4gHxO/Hottestfacesitting%2003%20Mistress%20Julya_thumb_0.jpg) (http://pimpandhost.com/image/63085980)

Download Links:

Hottestfacesitting 03 Mistress Julya.rar (http://k2s.cc/file/e1d569bb92279)
Title: Hottestfacesitting 030 Goddesses Natalya and Vika
Post by: squidmanheis on May 02, 2017, 03:45:53 pm
Hottestfacesitting 030 Goddesses Natalya and Vika

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/H/B/4gHBf/Hottestfacesitting%20030%20Goddesses%20Natalya%20and%20Vika%20_cover.jpg) (http://pimpandhost.com/image/63086193)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 030 Goddesses Natalya and Vika
Runtime : 12min 21s
File Size : 196 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/H/B/4gHBR/Hottestfacesitting%20030%20Goddesses%20Natalya%20and%20Vika%20_thumb_0.jpg) (http://pimpandhost.com/image/63086231)

Download Links:

Hottestfacesitting 030 Goddesses Natalya and Vika .rar (http://k2s.cc/file/5c68466fa2b13)
Title: Hottestfacesitting 031 Goddess Mary
Post by: squidmanheis on May 02, 2017, 07:02:11 pm
Hottestfacesitting 031 Goddess Mary

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/H/W/4gHWp/Hottestfacesitting%20031%20Goddess%20Mary%20_cover.jpg) (http://pimpandhost.com/image/63087505)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 031 Goddess Mary
Runtime : 9min 39s
File Size : 147 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/H/X/4gHX8/Hottestfacesitting%20031%20Goddess%20Mary%20_thumb_0.jpg) (http://pimpandhost.com/image/63087550)

Download Links:

Hottestfacesitting 031 Goddess Mary .rar (http://k2s.cc/file/c5400fe0f9c8a)
Title: Hottestfacesitting 032 Goddess July
Post by: squidmanheis on May 02, 2017, 10:18:42 pm
Hottestfacesitting 032 Goddess July

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/I/1/4gI1Q/Hottestfacesitting%20032%20Goddess%20July%20_cover.jpg) (http://pimpandhost.com/image/63087842)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 032 Goddess July
Runtime : 16min 24s
File Size : 260 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/I/1/4gI1U/Hottestfacesitting%20032%20Goddess%20July%20_thumb_0.jpg) (http://pimpandhost.com/image/63087846)

Download Links:

Hottestfacesitting 032 Goddess July .rar (http://k2s.cc/file/4733ca21d207e)
Title: Hottestfacesitting 033 Goddess Juliana
Post by: squidmanheis on May 03, 2017, 01:35:06 am
Hottestfacesitting 033 Goddess Juliana

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/I/j/4gIjb/Hottestfacesitting%20033%20Goddess%20Juliana%20_cover.jpg) (http://pimpandhost.com/image/63088917)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 033 Goddess Juliana
Runtime : 11min 16s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/I/k/4gIk9/Hottestfacesitting%20033%20Goddess%20Juliana%20_thumb_0.jpg) (http://pimpandhost.com/image/63088977)

Download Links:

Hottestfacesitting 033 Goddess Juliana .rar (http://k2s.cc/file/53172c3c33a35)
Title: Hottestfacesitting 034 Mistresses Dasha
Post by: squidmanheis on May 03, 2017, 04:51:40 am
Hottestfacesitting 034 Mistresses Dasha

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/I/q/4gIq2/Hottestfacesitting%20034%20Mistresses%20Dasha%20_cover.jpg) (http://pimpandhost.com/image/63089342)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 034 Mistresses Dasha
Runtime : 16min 35s
File Size : 252 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/I/q/4gIq4/Hottestfacesitting%20034%20Mistresses%20Dasha%20_thumb_0.jpg) (http://pimpandhost.com/image/63089344)

Download Links:

Hottestfacesitting 034 Mistresses Dasha .rar (http://k2s.cc/file/984925cd066f9)
Title: Hottestfacesitting 035 Goddess Dasha
Post by: squidmanheis on May 03, 2017, 08:08:14 am
Hottestfacesitting 035 Goddess Dasha

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/I/S/4gIS2/Hottestfacesitting%20035%20Goddess%20Dasha%20_cover.jpg) (http://pimpandhost.com/image/63091078)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 035 Goddess Dasha
Runtime : 14min 13s
File Size : 216 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/I/S/4gISD/Hottestfacesitting%20035%20Goddess%20Dasha%20_thumb_0.jpg) (http://pimpandhost.com/image/63091115)

Download Links:

Hottestfacesitting 035 Goddess Dasha .rar (http://k2s.cc/file/7f13b66b0acd9)
Title: Hottestfacesitting 036 Goddess Anna
Post by: squidmanheis on May 03, 2017, 11:24:28 am
Hottestfacesitting 036 Goddess Anna

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/1/4gJ1P/Hottestfacesitting%20036%20Goddess%20Anna%20_cover.jpg) (http://pimpandhost.com/image/63091685)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 036 Goddess Anna
Runtime : 14min 39s
File Size : 222 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/1/4gJ1Q/Hottestfacesitting%20036%20Goddess%20Anna%20_thumb_0.jpg) (http://pimpandhost.com/image/63091686)

Download Links:

Hottestfacesitting 036 Goddess Anna .rar (http://k2s.cc/file/a65a77e9649e2)
Title: Hottestfacesitting 038 Goddess Natalya
Post by: squidmanheis on May 03, 2017, 02:40:54 pm
Hottestfacesitting 038 Goddess Natalya

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/6/4gJ6w/Hottestfacesitting%20038%20Goddess%20Natalya%20_cover.jpg) (http://pimpandhost.com/image/63091976)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 038 Goddess Natalya
Runtime : 12min 39s
File Size : 192 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/6/4gJ6A/Hottestfacesitting%20038%20Goddess%20Natalya%20_thumb_0.jpg) (http://pimpandhost.com/image/63091980)

Download Links:

Hottestfacesitting 038 Goddess Natalya .rar (http://k2s.cc/file/88f806c0e8bcb)
Title: Hottestfacesitting 039 Goddesses Lera Aina
Post by: squidmanheis on May 03, 2017, 05:57:11 pm
Hottestfacesitting 039 Goddesses Lera  Aina

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/8/4gJ8g/Hottestfacesitting%20039%20Goddesses%20Lera%20%20Aina%20_cover.jpg) (http://pimpandhost.com/image/63092084)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 039 Goddesses Lera  Aina
Runtime : 13min 27s
File Size : 212 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/8/4gJ8i/Hottestfacesitting%20039%20Goddesses%20Lera%20%20Aina%20_thumb_0.jpg) (http://pimpandhost.com/image/63092086)

Download Links:

Hottestfacesitting 039 Goddesses Lera  Aina .rar (http://k2s.cc/file/b8df198ef06a7)
Title: Hottestfacesitting 04 Mistress Julia Mistress Lera
Post by: squidmanheis on May 03, 2017, 09:14:01 pm
Hottestfacesitting 04 Mistress Julia  Mistress Lera

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/k/4gJkt/Hottestfacesitting%2004%20Mistress%20Julia%20%20Mistress%20Lera%20_cover.jpg) (http://pimpandhost.com/image/63092841)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 04 Mistress Julia  Mistress Lera
Runtime : 11min 33s
File Size : 111 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/l/4gJlT/Hottestfacesitting%2004%20Mistress%20Julia%20%20Mistress%20Lera%20_thumb_0.jpg) (http://pimpandhost.com/image/63092929)

Download Links:

Hottestfacesitting 04 Mistress Julia  Mistress Lera .rar (http://k2s.cc/file/26dcfedf48fca)
Title: Hottestfacesitting 040 Young Anna
Post by: squidmanheis on May 04, 2017, 12:30:12 am
Hottestfacesitting 040 Young Anna

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/A/4gJAb/Hottestfacesitting%20040%20Young%20Anna%20_cover.jpg) (http://pimpandhost.com/image/63093815)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 040 Young Anna
Runtime : 14min 19s
File Size : 227 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/A/4gJAJ/Hottestfacesitting%20040%20Young%20Anna%20_thumb_0.jpg) (http://pimpandhost.com/image/63093849)

Download Links:

Hottestfacesitting 040 Young Anna .rar (http://k2s.cc/file/e19578ad365b3)
Title: Hottestfacesitting 041 FACESITTING and PUSSY WORSHIP
Post by: squidmanheis on May 04, 2017, 03:46:48 am
Hottestfacesitting 041 FACESITTING and PUSSY WORSHIP

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/F/4gJFL/Hottestfacesitting%20041%20FACESITTING%20and%20PUSSY%20WORSHIP%20_cover.jpg) (http://pimpandhost.com/image/63094161)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 041 FACESITTING and PUSSY WORSHIP
Runtime : 12min 25s
File Size : 197 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/F/4gJFO/Hottestfacesitting%20041%20FACESITTING%20and%20PUSSY%20WORSHIP%20_thumb_0.jpg) (http://pimpandhost.com/image/63094164)

Download Links:

Hottestfacesitting 041 FACESITTING and PUSSY WORSHIP .rar (http://k2s.cc/file/1d050cffe2de1)
Title: Hottestfacesitting 043 Young Goddess Anna
Post by: squidmanheis on May 04, 2017, 07:03:15 am
Hottestfacesitting 043 Young Goddess Anna

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/H/4gJHs/Hottestfacesitting%20043%20Young%20Goddess%20Anna_cover.jpg) (http://pimpandhost.com/image/63094266)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 043 Young Goddess Anna
Runtime : 13min 16s
File Size : 210 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/H/4gJHw/Hottestfacesitting%20043%20Young%20Goddess%20Anna_thumb_0.jpg) (http://pimpandhost.com/image/63094270)

Download Links:

Hottestfacesitting 043 Young Goddess Anna.rar (http://k2s.cc/file/61152802faa54)
Title: Hottestfacesitting 044 Three Sexy Mistresses Part One
Post by: squidmanheis on May 04, 2017, 10:19:40 am
Hottestfacesitting 044 Three Sexy Mistresses Part One

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/T/4gJTX/Hottestfacesitting%20044%20Three%20Sexy%20Mistresses%20Part%20One%20_cover.jpg) (http://pimpandhost.com/image/63095041)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 044 Three Sexy Mistresses Part One
Runtime : 14min 47s
File Size : 234 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/U/4gJU7/Hottestfacesitting%20044%20Three%20Sexy%20Mistresses%20Part%20One%20_thumb_0.jpg) (http://pimpandhost.com/image/63095051)

Download Links:

Hottestfacesitting 044 Three Sexy Mistresses Part One .rar (http://k2s.cc/file/78abaf073fe38)
Title: Hottestfacesitting 045 Goddesses Katya and Ksenya Part One
Post by: squidmanheis on May 04, 2017, 01:36:09 pm
Hottestfacesitting 045 Goddesses Katya and Ksenya Part One

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/k/4gKkT/Hottestfacesitting%20045%20Goddesses%20Katya%20and%20Ksenya%20Part%20One_cover.jpg) (http://pimpandhost.com/image/63096711)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 045 Goddesses Katya and Ksenya Part One
Runtime : 15min 38s
File Size : 248 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/k/4gKkV/Hottestfacesitting%20045%20Goddesses%20Katya%20and%20Ksenya%20Part%20One_thumb_0.jpg) (http://pimpandhost.com/image/63096713)

Download Links:

Hottestfacesitting 045 Goddesses Katya and Ksenya Part One.rar (http://k2s.cc/file/26d77bd86b870)
Title: Hottestfacesitting 046 Three Sexy Mistresses Part Two
Post by: squidmanheis on May 04, 2017, 04:52:31 pm
Hottestfacesitting 046 Three Sexy Mistresses Part Two

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/m/4gKmI/Hottestfacesitting%20046%20Three%20Sexy%20Mistresses%20Part%20Two%20_cover.jpg) (http://pimpandhost.com/image/63096824)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 046 Three Sexy Mistresses Part Two
Runtime : 13min 38s
File Size : 216 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/m/4gKmL/Hottestfacesitting%20046%20Three%20Sexy%20Mistresses%20Part%20Two%20_thumb_0.jpg) (http://pimpandhost.com/image/63096827)

Download Links:

Hottestfacesitting 046 Three Sexy Mistresses Part Two .rar (http://k2s.cc/file/99f7905004861)
Title: Hottestfacesitting 047 Pretty Young Goddess Liza
Post by: squidmanheis on May 04, 2017, 08:08:58 pm
Hottestfacesitting 047 Pretty Young Goddess Liza

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/o/4gKo3/Hottestfacesitting%20047%20Pretty%20Young%20Goddess%20Liza_cover.jpg) (http://pimpandhost.com/image/63096907)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 047 Pretty Young Goddess Liza
Runtime : 13min 2s
File Size : 207 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/o/4gKo6/Hottestfacesitting%20047%20Pretty%20Young%20Goddess%20Liza_thumb_0.jpg) (http://pimpandhost.com/image/63096910)

Download Links:

Hottestfacesitting 047 Pretty Young Goddess Liza.rar (http://k2s.cc/file/e8b0114a89664)
Title: Hottestfacesitting 048 Goddesses Katya and Ksenya Part Two
Post by: squidmanheis on May 04, 2017, 11:25:25 pm
Hottestfacesitting 048 Goddesses Katya and Ksenya Part Two

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/q/4gKqI/Hottestfacesitting%20048%20Goddesses%20Katya%20and%20Ksenya%20Part%20Two_cover.jpg) (http://pimpandhost.com/image/63097072)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 048 Goddesses Katya and Ksenya Part Two
Runtime : 13min 47s
File Size : 218 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/q/4gKqO/Hottestfacesitting%20048%20Goddesses%20Katya%20and%20Ksenya%20Part%20Two_thumb_0.jpg) (http://pimpandhost.com/image/63097078)

Download Links:

Hottestfacesitting 048 Goddesses Katya and Ksenya Part Two.rar (http://k2s.cc/file/c2d62c4fb3b60)
Title: Hottestfacesitting 049 Mistress Viki
Post by: squidmanheis on May 05, 2017, 02:41:51 am
Hottestfacesitting 049 Mistress Viki

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/t/4gKtF/Hottestfacesitting%20049%20Mistress%20Viki_cover.jpg) (http://pimpandhost.com/image/63097255)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 049 Mistress Viki
Runtime : 14min 11s
File Size : 224 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/t/4gKtR/Hottestfacesitting%20049%20Mistress%20Viki_thumb_0.jpg) (http://pimpandhost.com/image/63097267)

Download Links:

Hottestfacesitting 049 Mistress Viki.rar (http://k2s.cc/file/2e6c303d5cb98)
Title: Hottestfacesitting 05 Mistress Julya Mistress Dasha
Post by: squidmanheis on May 05, 2017, 05:58:20 am
Hottestfacesitting 05 Mistress Julya  Mistress Dasha

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/x/4gKxq/Hottestfacesitting%2005%20Mistress%20Julya%20%20Mistress%20Dasha_cover.jpg) (http://pimpandhost.com/image/63097488)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 05 Mistress Julya  Mistress Dasha
Runtime : 12min 26s
File Size : 119 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/x/4gKxR/Hottestfacesitting%2005%20Mistress%20Julya%20%20Mistress%20Dasha_thumb_0.jpg) (http://pimpandhost.com/image/63097515)

Download Links:

Hottestfacesitting 05 Mistress Julya  Mistress Dasha.rar (http://k2s.cc/file/35f58348c0252)
Title: Hottestfacesitting 050 Goddess Irena
Post by: squidmanheis on May 05, 2017, 09:14:47 am
Hottestfacesitting 050 Goddess Irena

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/F/4gKF9/Hottestfacesitting%20050%20Goddess%20Irena%20_cover.jpg) (http://pimpandhost.com/image/63097967)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 050 Goddess Irena
Runtime : 17min 33s
File Size : 258 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/F/4gKFc/Hottestfacesitting%20050%20Goddess%20Irena%20_thumb_0.jpg) (http://pimpandhost.com/image/63097970)

Download Links:

Hottestfacesitting 050 Goddess Irena .rar (http://k2s.cc/file/3bba5db544f44)
Title: Hottestfacesitting 051 Young Brunette Part One
Post by: squidmanheis on May 05, 2017, 12:31:11 pm
Hottestfacesitting 051 Young Brunette Part One

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/J/4gKJF/Hottestfacesitting%20051%20Young%20Brunette%20Part%20One_cover.jpg) (http://pimpandhost.com/image/63098247)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 051 Young Brunette Part One
Runtime : 10min 53s
File Size : 160 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/J/4gKJG/Hottestfacesitting%20051%20Young%20Brunette%20Part%20One_thumb_0.jpg) (http://pimpandhost.com/image/63098248)

Download Links:

Hottestfacesitting 051 Young Brunette Part One.rar (http://k2s.cc/file/7995db1e665d1)
Title: Hottestfacesitting 052
Post by: squidmanheis on May 05, 2017, 03:47:41 pm
Hottestfacesitting 052

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/O/4gKOe/Hottestfacesitting%20052_cover.jpg) (http://pimpandhost.com/image/63098530)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 052
Runtime : 18min 29s
File Size : 272 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/K/O/4gKOf/Hottestfacesitting%20052_thumb_0.jpg) (http://pimpandhost.com/image/63098531)

Download Links:

Hottestfacesitting 052.rar (http://k2s.cc/file/0f9c331847d23)
Title: Hottestfacesitting 053 Young Brunette Part Two
Post by: squidmanheis on May 05, 2017, 07:04:05 pm
Hottestfacesitting 053 Young Brunette Part Two

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/a/4gLaP/Hottestfacesitting%20053%20Young%20Brunette%20Part%20Two%20_cover.jpg) (http://pimpandhost.com/image/63099931)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 053 Young Brunette Part Two
Runtime : 14min 12s
File Size : 209 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/b/4gLbn/Hottestfacesitting%20053%20Young%20Brunette%20Part%20Two%20_thumb_0.jpg) (http://pimpandhost.com/image/63099965)

Download Links:

Hottestfacesitting 053 Young Brunette Part Two .rar (http://k2s.cc/file/f24afb9bf84ad)
Title: Hottestfacesitting 054
Post by: squidmanheis on May 05, 2017, 10:20:23 pm
Hottestfacesitting 054

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/i/4gLiY/Hottestfacesitting%20054_cover.jpg) (http://pimpandhost.com/image/63100436)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 054
Runtime : 17min 47s
File Size : 262 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/i/4gLiZ/Hottestfacesitting%20054_thumb_0.jpg) (http://pimpandhost.com/image/63100437)

Download Links:

Hottestfacesitting 054.rar (http://k2s.cc/file/e794edb9ff635)
Title: Hottestfacesitting 057
Post by: squidmanheis on May 06, 2017, 01:36:49 am
Hottestfacesitting 057

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/k/4gLky/Hottestfacesitting%20057_cover.jpg) (http://pimpandhost.com/image/63100534)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 057
Runtime : 11min 47s
File Size : 280 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/k/4gLkA/Hottestfacesitting%20057_thumb_0.jpg) (http://pimpandhost.com/image/63100536)

Download Links:

Hottestfacesitting 057.rar (http://k2s.cc/file/017e310bb8dc7)
Title: Hottestfacesitting 058
Post by: squidmanheis on May 06, 2017, 04:53:26 am
Hottestfacesitting 058

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/m/4gLmR/Hottestfacesitting%20058_cover.jpg) (http://pimpandhost.com/image/63100677)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 058
Runtime : 12min 51s
File Size : 304 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/m/4gLmV/Hottestfacesitting%20058_thumb_0.jpg) (http://pimpandhost.com/image/63100681)

Download Links:

Hottestfacesitting 058.rar (http://k2s.cc/file/4ae3efcd9f7c9)
Title: Hottestfacesitting 06 Mistress Tanya Mistress Lera
Post by: squidmanheis on May 06, 2017, 08:09:54 am
Hottestfacesitting 06 Mistress Tanya  Mistress Lera

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/A/4gLAL/Hottestfacesitting%2006%20Mistress%20Tanya%20%20Mistress%20Lera_cover.jpg) (http://pimpandhost.com/image/63101539)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 06 Mistress Tanya  Mistress Lera
Runtime : 10min 9s
File Size : 97.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/B/4gLBo/Hottestfacesitting%2006%20Mistress%20Tanya%20%20Mistress%20Lera_thumb_0.jpg) (http://pimpandhost.com/image/63101578)

Download Links:

Hottestfacesitting 06 Mistress Tanya  Mistress Lera.rar (http://k2s.cc/file/981140157a3b3)
Title: Hottestfacesitting 062
Post by: squidmanheis on May 06, 2017, 11:26:24 am
Hottestfacesitting 062

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/R/4gLRW/Hottestfacesitting%20062_cover.jpg) (http://pimpandhost.com/image/63102604)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 062
Runtime : 12min 36s
File Size : 299 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/L/S/4gLSE/Hottestfacesitting%20062_thumb_0.jpg) (http://pimpandhost.com/image/63102648)

Download Links:

Hottestfacesitting 062.rar (http://k2s.cc/file/5c4d69dee0578)
Title: Hottestfacesitting 063
Post by: squidmanheis on May 06, 2017, 02:42:49 pm
Hottestfacesitting 063

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/M/6/4gM66/Hottestfacesitting%20063_cover.jpg) (http://pimpandhost.com/image/63103482)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 063
Runtime : 10min 59s
File Size : 261 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/M/6/4gM6d/Hottestfacesitting%20063_thumb_0.jpg) (http://pimpandhost.com/image/63103489)

Download Links:

Hottestfacesitting 063.rar (http://k2s.cc/file/3c35d3d82b6ca)
Title: Hottestfacesitting 07 Mistress Nastya
Post by: squidmanheis on May 06, 2017, 05:59:15 pm
Hottestfacesitting 07 Mistress Nastya

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/M/d/4gMdN/Hottestfacesitting%2007%20Mistress%20Nastya_cover.jpg) (http://pimpandhost.com/image/63103959)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 07 Mistress Nastya
Runtime : 11min 28s
File Size : 110 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/M/d/4gMdU/Hottestfacesitting%2007%20Mistress%20Nastya_thumb_0.jpg) (http://pimpandhost.com/image/63103966)

Download Links:

Hottestfacesitting 07 Mistress Nastya.rar (http://k2s.cc/file/4aa0e3bdefc5c)
Title: Hottestfacesitting 08 Mistress Masha Mistress Anna
Post by: squidmanheis on May 06, 2017, 09:15:52 pm
Hottestfacesitting 08 Mistress Masha  Mistress Anna

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/M/k/4gMkJ/Hottestfacesitting%2008%20Mistress%20Masha%20%20Mistress%20Anna%20_cover.jpg) (http://pimpandhost.com/image/63104389)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 08 Mistress Masha  Mistress Anna
Runtime : 13min 30s
File Size : 129 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/M/k/4gMkK/Hottestfacesitting%2008%20Mistress%20Masha%20%20Mistress%20Anna%20_thumb_0.jpg) (http://pimpandhost.com/image/63104390)

Download Links:

Hottestfacesitting 08 Mistress Masha  Mistress Anna .rar (http://k2s.cc/file/ced6d97e5f047)
Title: Hottestfacesitting 09 Mistress Violeta
Post by: squidmanheis on May 07, 2017, 02:26:36 am
Hottestfacesitting 09 Mistress Violeta

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/M/o/4gMop/Hottestfacesitting%2009%20Mistress%20Violeta%20_cover.jpg) (http://pimpandhost.com/image/63104617)

Tags: Femdom, Facesitting, Smothering ...

File Name : Hottestfacesitting 09 Mistress Violeta
Runtime : 15min 16s
File Size : 143 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/M/o/4gMoD/Hottestfacesitting%2009%20Mistress%20Violeta%20_thumb_0.jpg) (http://pimpandhost.com/image/63104631)

Download Links:

Hottestfacesitting 09 Mistress Violeta .rar (http://k2s.cc/file/7fff810b35bf0)
Title: Facesitting 000112
Post by: squidmanheis on June 12, 2017, 05:53:26 pm
Facesitting 000112

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/K/4oTKq/Facesitting%20000112_cover.jpg) (http://pimpandhost.com/image/65039514)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 000112
Runtime : 6min 19s
File Size : 135 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/K/4oTKs/Facesitting%20000112_thumb_0.jpg) (http://pimpandhost.com/image/65039516)

Download Links:

Facesitting 000112.rar (http://k2s.cc/file/13ced4bf81096)
Title: Facesitting 000290
Post by: squidmanheis on June 12, 2017, 08:53:24 pm
Facesitting 000290

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/L/4oTLW/Facesitting%20000290_cover.jpg) (http://pimpandhost.com/image/65039608)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 000290
Runtime : 6min 14s
File Size : 112 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/M/4oTM1/Facesitting%20000290_thumb_0.jpg) (http://pimpandhost.com/image/65039613)

Download Links:

Facesitting 000290.rar (http://k2s.cc/file/20022cbc75680)
Title: Facesitting 000292
Post by: squidmanheis on June 12, 2017, 11:53:21 pm
Facesitting 000292

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/M/4oTMP/Facesitting%20000292_cover.jpg) (http://pimpandhost.com/image/65039663)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 000292
Runtime : 6min 36s
File Size : 118 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/M/4oTMS/Facesitting%20000292_thumb_0.jpg) (http://pimpandhost.com/image/65039666)

Download Links:

Facesitting 000292.rar (http://k2s.cc/file/5005471e572a4)
Title: Facesitting 000293
Post by: squidmanheis on June 13, 2017, 02:53:20 am
Facesitting 000293

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/N/4oTNH/Facesitting%20000293_cover.jpg) (http://pimpandhost.com/image/65039717)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 000293
Runtime : 6min 16s
File Size : 112 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/N/4oTNK/Facesitting%20000293_thumb_0.jpg) (http://pimpandhost.com/image/65039720)

Download Links:

Facesitting 000293.rar (http://k2s.cc/file/33c2fcd476afc)
Title: Facesitting 000294
Post by: squidmanheis on June 13, 2017, 05:53:17 am
Facesitting 000294

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/O/4oTOw/Facesitting%20000294_cover.jpg) (http://pimpandhost.com/image/65039768)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 000294
Runtime : 5min 44s
File Size : 103 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/O/4oTOA/Facesitting%20000294_thumb_0.jpg) (http://pimpandhost.com/image/65039772)

Download Links:

Facesitting 000294.rar (http://k2s.cc/file/361aa953f3ae2)
Title: Facesitting 000295
Post by: squidmanheis on June 13, 2017, 08:53:19 am
Facesitting 000295

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/Q/4oTQ0/Facesitting%20000295_cover.jpg) (http://pimpandhost.com/image/65039860)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 000295
Runtime : 6min 49s
File Size : 122 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/Q/4oTQ6/Facesitting%20000295_thumb_0.jpg) (http://pimpandhost.com/image/65039866)

Download Links:

Facesitting 000295.rar (http://k2s.cc/file/5b440fa2d14d9)
Title: Facesitting 000409
Post by: squidmanheis on June 13, 2017, 11:53:14 am
Facesitting 000409

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/R/4oTR9/Facesitting%20000409_cover.jpg) (http://pimpandhost.com/image/65039931)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 000409
Runtime : 7min 18s
File Size : 131 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/R/4oTRb/Facesitting%20000409_thumb_0.jpg) (http://pimpandhost.com/image/65039933)

Download Links:

Facesitting 000409.rar (http://k2s.cc/file/7fba3c42977af)
Title: Facesitting 001 031308 9605402200Pt1
Post by: squidmanheis on June 13, 2017, 02:53:13 pm
Facesitting 001 031308 9605402200Pt1

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/S/4oTSN/Facesitting%20001%20031308%209605402200Pt1_cover.jpg) (http://pimpandhost.com/image/65040033)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 001 031308 9605402200Pt1
Runtime : 5min 58s
File Size : 91.1 MB
File Type: asf
Resolution : 960x540

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/S/4oTSS/Facesitting%20001%20031308%209605402200Pt1_thumb_0.jpg) (http://pimpandhost.com/image/65040038)

Download Links:

Facesitting 001 031308 9605402200Pt1.rar (http://k2s.cc/file/8b2eff5b22976)
Title: Facesitting 002 031308 9605402200
Post by: squidmanheis on June 13, 2017, 05:53:11 pm
Facesitting 002 031308 9605402200

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/T/4oTTE/Facesitting%20002%20031308%209605402200_cover.jpg) (http://pimpandhost.com/image/65040086)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 002 031308 9605402200
Runtime : 7min 18s
File Size : 112 MB
File Type: asf
Resolution : 960x540

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/T/4oTTG/Facesitting%20002%20031308%209605402200_thumb_0.jpg) (http://pimpandhost.com/image/65040088)

Download Links:

Facesitting 002 031308 9605402200.rar (http://k2s.cc/file/af2c81f42c430)
Title: Facesitting 006 031308 9605402200
Post by: squidmanheis on June 13, 2017, 08:53:12 pm
Facesitting 006 031308 9605402200

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/U/4oTUO/Facesitting%20006%20031308%209605402200_cover.jpg) (http://pimpandhost.com/image/65040158)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 006 031308 9605402200
Runtime : 4min 39s
File Size : 71.3 MB
File Type: asf
Resolution : 960x540

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/U/4oTUP/Facesitting%20006%20031308%209605402200_thumb_0.jpg) (http://pimpandhost.com/image/65040159)

Download Links:

Facesitting 006 031308 9605402200.rar (http://k2s.cc/file/a7c5ead9bfdd8)
Title: Facesitting 126
Post by: squidmanheis on June 13, 2017, 11:53:09 pm
Facesitting 126

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/V/4oTVr/Facesitting%20126_cover.jpg) (http://pimpandhost.com/image/65040197)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 126
Runtime : 8min 53s
File Size : 215 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/V/4oTVv/Facesitting%20126_thumb_0.jpg) (http://pimpandhost.com/image/65040201)

Download Links:

Facesitting 126.rar (http://k2s.cc/file/5c99b50e60b8f)
Title: Facesitting 3436
Post by: squidmanheis on June 14, 2017, 02:53:06 am
Facesitting 3436


Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 3436
Runtime : 5min 20s
File Size : 61.1 MB
File Type: wmv
Resolution : 768x576


Download Links:

Facesitting 3436.rar (http://k2s.cc/file/aaae446299c50)
Title: Facesitting A Cuck is Born Asslicking
Post by: squidmanheis on June 14, 2017, 05:53:16 am
Facesitting A Cuck is Born - Asslicking

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/Z/4oTZ2/Facesitting%20A%20Cuck%20is%20Born%20-%20Asslicking_cover.jpg) (http://pimpandhost.com/image/65040420)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting A Cuck is Born - Asslicking
Runtime : 5min 58s
File Size : 248 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/Z/4oTZ6/Facesitting%20A%20Cuck%20is%20Born%20-%20Asslicking_thumb_0.jpg) (http://pimpandhost.com/image/65040424)

Download Links:

Facesitting A Cuck is Born - Asslicking.rar (http://k2s.cc/file/ca8dc5f7e31f7)
Title: Facesitting Alexis Virgin Slave Danni Eats his First Pussy
Post by: squidmanheis on June 14, 2017, 08:53:02 am
Facesitting Alexis - Virgin Slave Danni Eats his First Pussy

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/1/4oU13/Facesitting%20Alexis%20-%20Virgin%20Slave%20Danni%20Eats%20his%20First%20Pussy_cover.jpg) (http://pimpandhost.com/image/65040545)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Alexis - Virgin Slave Danni Eats his First Pussy
Runtime : 9min 47s
File Size : 241 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/1/4oU17/Facesitting%20Alexis%20-%20Virgin%20Slave%20Danni%20Eats%20his%20First%20Pussy_thumb_0.jpg) (http://pimpandhost.com/image/65040549)

Download Links:

Facesitting Alexis - Virgin Slave Danni Eats his First Pussy.rar (http://k2s.cc/file/d700cdb884124)
Title: Facesitting Alexis face sits tiny danny in a sexy bikini
Post by: squidmanheis on June 14, 2017, 11:53:03 am
Facesitting Alexis face sits tiny danny in a sexy bikini

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/3/4oU3m/Facesitting%20Alexis%20face%20sits%20tiny%20danny%20in%20a%20sexy%20bikini_cover.jpg) (http://pimpandhost.com/image/65040688)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Alexis face sits tiny danny in a sexy bikini
Runtime : 8min 37s
File Size : 130 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/3/4oU3o/Facesitting%20Alexis%20face%20sits%20tiny%20danny%20in%20a%20sexy%20bikini_thumb_0.jpg) (http://pimpandhost.com/image/65040690)

Download Links:

Facesitting Alexis face sits tiny danny in a sexy bikini.rar (http://k2s.cc/file/32008d8970ea6)
Title: Facesitting alexiscuckoldbitch1
Post by: squidmanheis on June 14, 2017, 02:53:02 pm
Facesitting alexiscuckoldbitch1

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/4/4oU4z/Facesitting%20alexiscuckoldbitch1_cover.jpg) (http://pimpandhost.com/image/65040763)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting alexiscuckoldbitch1
Runtime : 5min 44s
File Size : 89.1 MB
File Type: wmv
Resolution : 960x540

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/4/4oU4C/Facesitting%20alexiscuckoldbitch1_thumb_0.jpg) (http://pimpandhost.com/image/65040766)

Download Links:

Facesitting alexiscuckoldbitch1.rar (http://k2s.cc/file/4db0f8c32a22a)
Title: Facesitting All up in that ass
Post by: squidmanheis on June 14, 2017, 05:52:57 pm
Facesitting All up in that ass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/5/4oU5j/Facesitting%20All%20up%20in%20that%20ass_cover.jpg) (http://pimpandhost.com/image/65040809)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting All up in that ass
Runtime : 15min 11s
File Size : 227 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/5/4oU5k/Facesitting%20All%20up%20in%20that%20ass_thumb_0.jpg) (http://pimpandhost.com/image/65040810)

Download Links:

Facesitting All up in that ass.rar (http://k2s.cc/file/721ff525d3e59)
Title: Facesitting american fw
Post by: squidmanheis on June 14, 2017, 08:52:58 pm
Facesitting american fw

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/s/4oYsM/Facesitting%20american%20fw_cover.jpg) (http://pimpandhost.com/image/65057640)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting american fw
Runtime : 10min 44s
File Size : 129 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/s/4oYsP/Facesitting%20american%20fw_thumb_0.jpg) (http://pimpandhost.com/image/65057643)

Download Links:

Facesitting american fw.rar (http://k2s.cc/file/27e4dde812365)
Title: Facesitting aside
Post by: squidmanheis on June 14, 2017, 11:53:45 pm
Facesitting aside

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/9/4oU9c/Facesitting%20aside_cover.jpg) (http://pimpandhost.com/image/65041050)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting aside
Runtime : 5min 26s
File Size : 60.0 MB
File Type: wmv
Resolution : 720x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/9/4oU9d/Facesitting%20aside_thumb_0.jpg) (http://pimpandhost.com/image/65041051)

Download Links:

Facesitting aside.rar (http://k2s.cc/file/69208b163f010)
Title: Facesitting asl896
Post by: squidmanheis on June 15, 2017, 02:53:44 am
Facesitting asl896

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/a/4oUah/Facesitting%20asl896_cover.jpg) (http://pimpandhost.com/image/65041117)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting asl896
Runtime : 5min 49s
File Size : 104 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/a/4oUal/Facesitting%20asl896_thumb_0.jpg) (http://pimpandhost.com/image/65041121)

Download Links:

Facesitting asl896.rar (http://k2s.cc/file/3e615b3c30932)
Title: Facesitting Ass tall brunette
Post by: squidmanheis on June 15, 2017, 05:53:42 am
Facesitting Ass tall brunette

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/f/4oUfW/Facesitting%20Ass%20tall%20brunette_cover.jpg) (http://pimpandhost.com/image/65041468)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Ass tall brunette
Runtime : 13min 41s
File Size : 191 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/g/4oUg0/Facesitting%20Ass%20tall%20brunette_thumb_0.jpg) (http://pimpandhost.com/image/65041472)

Download Links:

Facesitting Ass tall brunette.rar (http://k2s.cc/file/cfe49abe5dbbe)
Title: Facesitting benmn
Post by: squidmanheis on June 15, 2017, 08:53:49 am
Facesitting benmn

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/t/4oYt0/Facesitting%20benmn_cover.jpg) (http://pimpandhost.com/image/65057654)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting benmin
Runtime : 8min 49s
File Size : 87.4 MB
File Type: mp4
Resolution : 1590x718

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/t/4oYt4/Facesitting%20benmn_thumb_0.jpg) (http://pimpandhost.com/image/65057658)

Download Links:

Facesitting benmn.rar (http://k2s.cc/file/12502bd543590)
Title: Facesitting Best Pussy Eating Amazing Close Up Licking
Post by: squidmanheis on June 15, 2017, 11:53:38 am
Facesitting Best Pussy Eating Amazing Close Up Licking


Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Best Pussy Eating Amazing Close Up Licking
Runtime : 6min 37s
File Size : 162 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/k/4oUk4/Facesitting%20Best%20Pussy%20Eating%20Amazing%20Close%20Up%20Licking_thumb_0.jpg) (http://pimpandhost.com/image/65041724)

Download Links:

Facesitting Best Pussy Eating Amazing Close Up Licking.rar (http://k2s.cc/file/3c1a74238e425)
Title: Facesitting boss getting her ass licked in heels
Post by: squidmanheis on June 15, 2017, 02:53:40 pm
Facesitting boss getting her ass licked in heels

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/n/4oUnA/Facesitting%20boss%20getting%20her%20ass%20licked%20in%20heels_cover.jpg) (http://pimpandhost.com/image/65041942)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting boss getting her ass licked in heels
Runtime : 7min 6s
File Size : 113 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/n/4oUnF/Facesitting%20boss%20getting%20her%20ass%20licked%20in%20heels_thumb_0.jpg) (http://pimpandhost.com/image/65041947)

Download Links:

Facesitting boss getting her ass licked in heels.rar (http://k2s.cc/file/801ba0cc75fb2)
Title: Facesitting Boyfriend Eating And Munching Pussy
Post by: squidmanheis on June 15, 2017, 05:53:36 pm
Facesitting Boyfriend Eating And Munching Pussy

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/q/4oUqj/Facesitting%20Boyfriend%20Eating%20And%20Munching%20Pussy_cover.jpg) (http://pimpandhost.com/image/65042111)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Boyfriend Eating And Munching Pussy
Runtime : 5min 47s
File Size : 162 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/q/4oUql/Facesitting%20Boyfriend%20Eating%20And%20Munching%20Pussy_thumb_0.jpg) (http://pimpandhost.com/image/65042113)

Download Links:

Facesitting Boyfriend Eating And Munching Pussy.rar (http://k2s.cc/file/0bf854ce712c2)
Title: Facesitting buried in ass
Post by: squidmanheis on June 15, 2017, 08:55:24 pm
Facesitting buried in ass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/u/4oUun/Facesitting%20buried%20in%20ass_cover.jpg) (http://pimpandhost.com/image/65042363)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting buried in ass
Runtime : 7min 4s
File Size : 107 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/u/4oUuv/Facesitting%20buried%20in%20ass_thumb_0.jpg) (http://pimpandhost.com/image/65042371)

Download Links:

Facesitting buried in ass.rar (http://k2s.cc/file/fa7c8985d40ff)
Title: Facesitting CD 04 13 13 assworship
Post by: squidmanheis on June 15, 2017, 11:53:31 pm
Facesitting CD 04 13 13 assworship

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/B/4oUB0/Facesitting%20CD%2004%2013%2013%20assworship_cover.jpg) (http://pimpandhost.com/image/65042774)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting CD 04 13 13 assworship
Runtime : 7min 13s
File Size : 212 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/B/4oUB7/Facesitting%20CD%2004%2013%2013%20assworship_thumb_0.jpg) (http://pimpandhost.com/image/65042781)

Download Links:

Facesitting CD 04 13 13 assworship.rar (http://k2s.cc/file/b452cb6f77bf4)
Title: Facesitting Cheater Smothered
Post by: squidmanheis on June 16, 2017, 02:53:31 am
Facesitting Cheater Smothered

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/I/4oUIj/Facesitting%20Cheater%20Smothered_cover.jpg) (http://pimpandhost.com/image/65043227)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Cheater Smothered
Runtime : 12min 59s
File Size : 147 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/I/4oUIs/Facesitting%20Cheater%20Smothered_thumb_0.jpg) (http://pimpandhost.com/image/65043236)

Download Links:

Facesitting Cheater Smothered.rar (http://k2s.cc/file/dfd898dc919d6)
Title: Facesitting cl 1069
Post by: squidmanheis on June 16, 2017, 05:53:32 am
Facesitting cl 1069

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/N/4oUNN/Facesitting%20cl%201069_cover.jpg) (http://pimpandhost.com/image/65043567)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting cl 1069
Runtime : 8min 37s
File Size : 264 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/N/4oUNX/Facesitting%20cl%201069_thumb_0.jpg) (http://pimpandhost.com/image/65043577)

Download Links:

Facesitting cl 1069.rar (http://k2s.cc/file/e6b9670b47864)
Title: Facesitting cl 1471
Post by: squidmanheis on June 16, 2017, 08:53:30 am
Facesitting cl 1471

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/T/4oUTq/Facesitting%20cl%201471_cover.jpg) (http://pimpandhost.com/image/65043916)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting cl 1471
Runtime : 9min 48s
File Size : 195 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/T/4oUTs/Facesitting%20cl%201471_thumb_0.jpg) (http://pimpandhost.com/image/65043918)

Download Links:

Facesitting cl 1471.rar (http://k2s.cc/file/545e95c0a153b)
Title: Facesitting cl 1475
Post by: squidmanheis on June 16, 2017, 11:53:34 am
Facesitting cl 1475

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/W/4oUWd/Facesitting%20cl%201475_cover.jpg) (http://pimpandhost.com/image/65044089)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting cl 1475
Runtime : 6min 21s
File Size : 79.1 MB
File Type: wmv
Resolution : 1024x576

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/W/4oUWe/Facesitting%20cl%201475_thumb_0.jpg) (http://pimpandhost.com/image/65044090)

Download Links:

Facesitting cl 1475.rar (http://k2s.cc/file/2fc031b40368a)
Title: Facesitting cl 1483
Post by: squidmanheis on June 16, 2017, 02:53:25 pm
Facesitting cl 1483

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/X/4oUXb/Facesitting%20cl%201483_cover.jpg) (http://pimpandhost.com/image/65044149)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting cl 1483
Runtime : 6min 38s
File Size : 175 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/U/X/4oUXf/Facesitting%20cl%201483_thumb_0.jpg) (http://pimpandhost.com/image/65044153)

Download Links:

Facesitting cl 1483.rar (http://k2s.cc/file/e3f71276e6ad9)
Title: Facesitting cl 185
Post by: squidmanheis on June 16, 2017, 05:53:24 pm
Facesitting cl 185


Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting cl 185
Runtime : 5min 40s
File Size : 65.2 MB
File Type: wmv
Resolution : 1024x576

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/0/4oV0y/Facesitting%20cl%20185_thumb_0.jpg) (http://pimpandhost.com/image/65044358)

Download Links:

Facesitting cl 185.rar (http://k2s.cc/file/c235eaf8b6829)
Title: Facesitting cl 90
Post by: squidmanheis on June 16, 2017, 08:53:23 pm
Facesitting cl 90

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/1/4oV1f/Facesitting%20cl%2090_cover.jpg) (http://pimpandhost.com/image/65044401)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting cl 90
Runtime : 8min 8s
File Size : 75.2 MB
File Type: wmv
Resolution : 1024x576

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/1/4oV1h/Facesitting%20cl%2090_thumb_0.jpg) (http://pimpandhost.com/image/65044403)

Download Links:

Facesitting cl 90.rar (http://k2s.cc/file/ce4de8612fd93)
Title: Facesitting Claires Feet Sniffing After Dancing All Night
Post by: squidmanheis on June 16, 2017, 11:53:20 pm
Facesitting Claires Feet Sniffing After Dancing All Night

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/1/4oV1O/Facesitting%20Claires%20Feet%20Sniffing%20After%20Dancing%20All%20Night_cover.jpg) (http://pimpandhost.com/image/65044436)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Claires Feet Sniffing After Dancing All Night
Runtime : 5min 25s
File Size : 84.2 MB
File Type: asf
Resolution : 960x540

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/1/4oV1R/Facesitting%20Claires%20Feet%20Sniffing%20After%20Dancing%20All%20Night_thumb_0.jpg) (http://pimpandhost.com/image/65044439)

Download Links:

Facesitting Claires Feet Sniffing After Dancing All Night.rar (http://k2s.cc/file/8e5cc82bf3fc9)
Title: Facesitting Clip 008695
Post by: squidmanheis on June 17, 2017, 02:53:19 am
Facesitting Clip 008695

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/2/4oV2N/Facesitting%20Clip%20008695_cover.jpg) (http://pimpandhost.com/image/65044497)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Clip 008695
Runtime : 10min 8s
File Size : 148 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/2/4oV2Q/Facesitting%20Clip%20008695_thumb_0.jpg) (http://pimpandhost.com/image/65044500)

Download Links:

Facesitting Clip 008695.rar (http://k2s.cc/file/9d6aba46c58aa)
Title: Facesitting Clip 011392
Post by: squidmanheis on June 17, 2017, 05:53:18 am
Facesitting Clip 011392

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/4/4oV46/Facesitting%20Clip%20011392_cover.jpg) (http://pimpandhost.com/image/65044578)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Clip 011392
Runtime : 5min 0s
File Size : 167 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/4/4oV47/Facesitting%20Clip%20011392_thumb_0.jpg) (http://pimpandhost.com/image/65044579)

Download Links:

Facesitting Clip 011392.rar (http://k2s.cc/file/12c9b1e8b2e3c)
Title: Facesitting clip218 Small dick eat pussy
Post by: squidmanheis on June 17, 2017, 08:53:17 am
Facesitting clip218 Small dick eat pussy

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/5/4oV5A/Facesitting%20clip218%20Small%20dick%20eat%20pussy_cover.jpg) (http://pimpandhost.com/image/65044670)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting clip218 Small dick eat pussy
Runtime : 4min 15s
File Size : 65.0 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/5/4oV5D/Facesitting%20clip218%20Small%20dick%20eat%20pussy_thumb_0.jpg) (http://pimpandhost.com/image/65044673)

Download Links:

Facesitting clip218 Small dick eat pussy.rar (http://k2s.cc/file/f90e16e1cfa96)
Title: Facesitting clip264 pussy eat 2
Post by: squidmanheis on June 17, 2017, 11:53:15 am
Facesitting clip264 pussy eat 2

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/6/4oV6e/Facesitting%20clip264%20pussy%20eat%202_cover.jpg) (http://pimpandhost.com/image/65044710)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting clip264 pussy eat 2
Runtime : 6min 22s
File Size : 96.9 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/6/4oV6g/Facesitting%20clip264%20pussy%20eat%202_thumb_0.jpg) (http://pimpandhost.com/image/65044712)

Download Links:

Facesitting clip264 pussy eat 2.rar (http://k2s.cc/file/7c7acd15c46c3)
Title: Facesitting CMIPFB72
Post by: squidmanheis on June 17, 2017, 02:53:15 pm
Facesitting CMIPFB72

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/7/4oV71/Facesitting%20CMIPFB72_cover.jpg) (http://pimpandhost.com/image/65044759)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting CMIPFB72
Runtime : 3min 1s
File Size : 178 MB
File Type: mp4
Resolution : 1920x1080

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/7/4oV73/Facesitting%20CMIPFB72_thumb_0.jpg) (http://pimpandhost.com/image/65044761)

Download Links:

Facesitting CMIPFB72.rar (http://k2s.cc/file/274df85d6cd1a)
Title: Facesitting Come Here Bitch
Post by: squidmanheis on June 17, 2017, 05:53:12 pm
Facesitting Come Here Bitch

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/9/4oV9K/Facesitting%20Come%20Here%20Bitch_cover.jpg) (http://pimpandhost.com/image/65044928)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Come Here Bitch
Runtime : 6min 31s
File Size : 176 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/9/4oV9N/Facesitting%20Come%20Here%20Bitch_thumb_0.jpg) (http://pimpandhost.com/image/65044931)

Download Links:

Facesitting Come Here Bitch.rar (http://k2s.cc/file/7f913b2e117eb)
Title: Facesitting Dirty Tina Der Leckdiener
Post by: squidmanheis on June 17, 2017, 08:53:11 pm
Facesitting Dirty-Tina - Der Leckdiener

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/i/4oViY/Facesitting%20Dirty-Tina%20-%20Der%20Leckdiener_cover.jpg) (http://pimpandhost.com/image/65045500)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Dirty-Tina - Der Leckdiener
Runtime : 2min 53s
File Size : 53.7 MB
File Type: flv
Resolution : 1920x1080

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/j/4oVjg/Facesitting%20Dirty-Tina%20-%20Der%20Leckdiener_thumb_0.jpg) (http://pimpandhost.com/image/65045518)

Download Links:

Facesitting Dirty-Tina - Der Leckdiener.rar (http://k2s.cc/file/3aa4603ab3064)
Title: Facesitting dom girls facesit 1
Post by: squidmanheis on June 17, 2017, 11:52:41 pm
Facesitting dom girls facesit 1

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/j/4oVjy/Facesitting%20dom%20girls%20facesit%201_cover.jpg) (http://pimpandhost.com/image/65045536)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting dom girls facesit 1
Runtime : 10min 6s
File Size : 121 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/j/4oVjA/Facesitting%20dom%20girls%20facesit%201_thumb_0.jpg) (http://pimpandhost.com/image/65045538)

Download Links:

Facesitting dom girls facesit 1.rar (http://k2s.cc/file/098a71fbb0e64)
Title: Facesitting Eat My Pussy Bitch
Post by: squidmanheis on June 18, 2017, 02:38:52 pm
Facesitting Eat My Pussy Bitch

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/y/4oVyl/Facesitting%20Eat%20My%20Pussy%20Bitch_cover.jpg) (http://pimpandhost.com/image/65046453)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Eat My Pussy Bitch
Runtime : 10min 7s
File Size : 273 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/y/4oVyq/Facesitting%20Eat%20My%20Pussy%20Bitch_thumb_0.jpg) (http://pimpandhost.com/image/65046458)

Download Links:

Facesitting Eat My Pussy Bitch.rar (http://k2s.cc/file/42b90e48c8f25)
Title: Facesitting DT639
Post by: squidmanheis on June 18, 2017, 03:36:14 pm
Facesitting DT639

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/k/4oVkC/Facesitting%20DT639_cover.jpg) (http://pimpandhost.com/image/65045602)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting DT639
Runtime : 8min 38s
File Size : 76.1 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/l/4oVl1/Facesitting%20DT639_thumb_0.jpg) (http://pimpandhost.com/image/65045627)

Download Links:

Facesitting DT639.rar (http://k2s.cc/file/4b89b61b727d7)
Title: Facesitting esmer
Post by: squidmanheis on June 18, 2017, 05:52:33 pm
Facesitting esmer

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/t/4oYt7/Facesitting%20esmer_cover.jpg) (http://pimpandhost.com/image/65057661)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting esmer
Runtime : 9min 8s
File Size : 140 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/t/4oYt8/Facesitting%20esmer_thumb_0.jpg) (http://pimpandhost.com/image/65057662)

Download Links:

Facesitting esmer.rar (http://k2s.cc/file/09a50c4a43985)
Title: Facesitting Face fucked with her hairy pussy
Post by: squidmanheis on June 18, 2017, 08:52:33 pm
Facesitting Face fucked with her hairy pussy

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/T/4oVT2/Facesitting%20Face%20fucked%20with%20her%20hairy%20pussy_cover.jpg) (http://pimpandhost.com/image/65047736)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Face fucked with her hairy pussy
Runtime : 6min 14s
File Size : 76.2 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/T/4oVT5/Facesitting%20Face%20fucked%20with%20her%20hairy%20pussy_thumb_0.jpg) (http://pimpandhost.com/image/65047739)

Download Links:

Facesitting Face fucked with her hairy pussy.rar (http://k2s.cc/file/bd7b77a1520c3)
Title: Facesitting Facesitting fun
Post by: squidmanheis on June 18, 2017, 11:52:36 pm
Facesitting Facesitting fun

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/T/4oVTD/Facesitting%20Facesitting%20fun_cover.jpg) (http://pimpandhost.com/image/65047773)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Facesitting fun
Runtime : 7min 0s
File Size : 97.2 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/T/4oVTJ/Facesitting%20Facesitting%20fun_thumb_0.jpg) (http://pimpandhost.com/image/65047779)

Download Links:

Facesitting Facesitting fun.rar (http://k2s.cc/file/2b8bc4d8c5a16)
Title: Facesitting fart Cece Stone 3
Post by: squidmanheis on June 19, 2017, 02:52:35 am
Facesitting fart Cece Stone 3

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/Y/4oVYm/Facesitting%20fart%20Cece%20Stone%203_cover.jpg) (http://pimpandhost.com/image/65048066)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fart Cece Stone 3
Runtime : 3min 57s
File Size : 173 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/V/Y/4oVYn/Facesitting%20fart%20Cece%20Stone%203_thumb_0.jpg) (http://pimpandhost.com/image/65048067)

Download Links:

Facesitting fart Cece Stone 3.rar (http://k2s.cc/file/e823691aeb51e)
Title: Facesitting fart Lucky Starr 14
Post by: squidmanheis on June 19, 2017, 05:52:32 am
Facesitting fart Lucky Starr 14

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/3/4oW3g/Facesitting%20fart%20Lucky%20Starr%2014_cover.jpg) (http://pimpandhost.com/image/65048370)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fart Lucky Starr 14
Runtime : 3min 23s
File Size : 148 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/3/4oW3o/Facesitting%20fart%20Lucky%20Starr%2014_thumb_0.jpg) (http://pimpandhost.com/image/65048378)

Download Links:

Facesitting fart Lucky Starr 14.rar (http://k2s.cc/file/dab6072de67fb)
Title: Facesitting fart Melody Nakai 6
Post by: squidmanheis on June 19, 2017, 08:52:33 am
Facesitting fart Melody Nakai 6

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/9/4oW9O/Facesitting%20fart%20Melody%20Nakai%206_cover.jpg) (http://pimpandhost.com/image/65048776)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fart Melody Nakai 6
Runtime : 9min 30s
File Size : 74.3 MB
File Type: mp4
Resolution : 852x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/a/4oWaf/Facesitting%20fart%20Melody%20Nakai%206_thumb_0.jpg) (http://pimpandhost.com/image/65048803)

Download Links:

Facesitting fart Melody Nakai 6.rar (http://k2s.cc/file/e74646c4cdb80)
Title: Facesitting fart Savannah Fox 11
Post by: squidmanheis on June 19, 2017, 11:52:31 am
Facesitting fart Savannah Fox 11

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/c/4oWct/Facesitting%20fart%20Savannah%20Fox%2011_cover.jpg) (http://pimpandhost.com/image/65048941)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fart Savannah Fox 11
Runtime : 4min 42s
File Size : 205 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/c/4oWcu/Facesitting%20fart%20Savannah%20Fox%2011_thumb_0.jpg) (http://pimpandhost.com/image/65048942)

Download Links:

Facesitting fart Savannah Fox 11.rar (http://k2s.cc/file/0abce064cefa8)
Title: Facesitting fart Savannah Fox 12
Post by: squidmanheis on June 19, 2017, 02:52:33 pm
Facesitting fart Savannah Fox 12

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/h/4oWhs/Facesitting%20fart%20Savannah%20Fox%2012_cover.jpg) (http://pimpandhost.com/image/65049250)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fart Savannah Fox 12
Runtime : 3min 43s
File Size : 163 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/h/4oWht/Facesitting%20fart%20Savannah%20Fox%2012_thumb_0.jpg) (http://pimpandhost.com/image/65049251)

Download Links:

Facesitting fart Savannah Fox 12.rar (http://k2s.cc/file/54890ef6e9882)
Title: Facesitting fas16
Post by: squidmanheis on June 19, 2017, 05:52:29 pm
Facesitting fas16

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/m/4oWmC/Facesitting%20fas16_cover.jpg) (http://pimpandhost.com/image/65049570)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fas16
Runtime : 9min 45s
File Size : 245 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/m/4oWmH/Facesitting%20fas16_thumb_0.jpg) (http://pimpandhost.com/image/65049575)

Download Links:

Facesitting fas16.rar (http://k2s.cc/file/27385839ba278)
Title: Facesitting feettopussy 1
Post by: squidmanheis on June 19, 2017, 08:52:27 pm
Facesitting feettopussy 1

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/u/4oWuZ/Facesitting%20feettopussy%201_cover.jpg) (http://pimpandhost.com/image/65050089)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting feettopussy 1
Runtime : 6min 13s
File Size : 145 MB
File Type: avi
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/v/4oWv3/Facesitting%20feettopussy%201_thumb_0.jpg) (http://pimpandhost.com/image/65050093)

Download Links:

Facesitting feettopussy 1.rar (http://k2s.cc/file/50ba09d101c2a)
Title: Facesitting femdom uncut fs european girl
Post by: squidmanheis on June 19, 2017, 11:52:24 pm
Facesitting femdom uncut fs european girl

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/w/4oWw7/Facesitting%20femdom%20uncut%20fs%20european%20girl_cover.jpg) (http://pimpandhost.com/image/65050159)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting femdom uncut fs european girl
Runtime : 18min 5s
File Size : 252 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/w/4oWwa/Facesitting%20femdom%20uncut%20fs%20european%20girl_thumb_0.jpg) (http://pimpandhost.com/image/65050162)

Download Links:

Facesitting femdom uncut fs european girl.rar (http://k2s.cc/file/74b2a8ed99763)
Title: Facesitting FO566 dhghg39Fa
Post by: squidmanheis on June 20, 2017, 04:32:56 am
Facesitting FO566-dhghg39Fa

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/x/4oWxP/Facesitting%20FO566-dhghg39Fa_cover.jpg) (http://pimpandhost.com/image/65050265)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting FO566-dhghg39Fa
Runtime : 10min 31s
File Size : 154 MB
File Type: wmv
Resolution : 960x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/x/4oWxR/Facesitting%20FO566-dhghg39Fa_thumb_0.jpg) (http://pimpandhost.com/image/65050267)

Download Links:

Facesitting FO566-dhghg39Fa.rar (http://k2s.cc/file/5e43eb36462c8)
Title: Facesitting Friends lick ass
Post by: squidmanheis on June 20, 2017, 05:52:24 am
Facesitting Friends lick ass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/A/4oWAs/Facesitting%20Friends%20lick%20ass_cover.jpg) (http://pimpandhost.com/image/65050428)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Friends lick ass
Runtime : 8min 49s
File Size : 135 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/A/4oWAz/Facesitting%20Friends%20lick%20ass_thumb_0.jpg) (http://pimpandhost.com/image/65050435)

Download Links:

Facesitting Friends lick ass.rar (http://k2s.cc/file/b9e5ad7bc9ef3)
Title: Facesitting FS AIR
Post by: squidmanheis on June 20, 2017, 08:52:21 am
Facesitting FS AIR

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/C/4oWCA/Facesitting%20FS%20AIR_cover.jpg) (http://pimpandhost.com/image/65050560)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting FS AIR
Runtime : 7min 43s
File Size : 50.0 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/C/4oWCE/Facesitting%20FS%20AIR_thumb_0.jpg) (http://pimpandhost.com/image/65050564)

Download Links:

Facesitting FS AIR.rar (http://k2s.cc/file/d22cdff0e6e38)
Title: Facesitting fs ch 2
Post by: squidmanheis on June 20, 2017, 11:52:22 am
Facesitting fs ch 2

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/D/4oWDa/Facesitting%20fs%20ch%202_cover.jpg) (http://pimpandhost.com/image/65050596)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fs ch 2
Runtime : 7min 43s
File Size : 50.0 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/D/4oWDe/Facesitting%20fs%20ch%202_thumb_0.jpg) (http://pimpandhost.com/image/65050600)

Download Links:

Facesitting fs ch 2.rar (http://k2s.cc/file/de9eb53d7ea87)
Title: Facesitting FS CH
Post by: squidmanheis on June 20, 2017, 02:52:18 pm
Facesitting FS CH

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/D/4oWDW/Facesitting%20FS%20CH_cover.jpg) (http://pimpandhost.com/image/65050644)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting FS CH
Runtime : 7min 36s
File Size : 87.5 MB
File Type: wmv
Resolution : 860x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/D/4oWDY/Facesitting%20FS%20CH_thumb_0.jpg) (http://pimpandhost.com/image/65050646)

Download Links:

Facesitting FS CH.rar (http://k2s.cc/file/3a3089a8fc3a9)
Title: Facesitting FS MAS cunni
Post by: squidmanheis on June 20, 2017, 05:52:17 pm
Facesitting FS MAS cunni

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/F/4oWF9/Facesitting%20FS%20MAS%20cunni_cover.jpg) (http://pimpandhost.com/image/65050719)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting FS MAS cunni
Runtime : 6min 6s
File Size : 88.7 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/F/4oWFc/Facesitting%20FS%20MAS%20cunni_thumb_0.jpg) (http://pimpandhost.com/image/65050722)

Download Links:

Facesitting FS MAS cunni.rar (http://k2s.cc/file/5e7bdb17be6b4)
Title: Facesitting fs yng russian hairy
Post by: squidmanheis on June 20, 2017, 08:52:15 pm
Facesitting fs yng russian hairy

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/G/4oWG8/Facesitting%20fs%20yng%20russian%20hairy_cover.jpg) (http://pimpandhost.com/image/65050780)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fs yng russian hairy
Runtime : 26min 30s
File Size : 135 MB
File Type: mp4
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/G/4oWGc/Facesitting%20fs%20yng%20russian%20hairy_thumb_0.jpg) (http://pimpandhost.com/image/65050784)

Download Links:

Facesitting fs yng russian hairy.rar (http://k2s.cc/file/ab4a305dc2379)
Title: Facesitting Galilea Cunnius
Post by: squidmanheis on June 20, 2017, 11:52:13 pm
Facesitting Galilea Cunnius

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/H/4oWHe/Facesitting%20Galilea%20Cunnius_cover.jpg) (http://pimpandhost.com/image/65050848)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Galilea Cunnius
Runtime : 7min 8s
File Size : 240 MB
File Type: mp4
Resolution : 1920x1080

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/H/4oWHh/Facesitting%20Galilea%20Cunnius_thumb_0.jpg) (http://pimpandhost.com/image/65050851)

Download Links:

Facesitting Galilea Cunnius.rar (http://k2s.cc/file/d5e0403cd7916)
Title: Facesitting glass facesitting guzel american
Post by: squidmanheis on June 21, 2017, 02:52:12 am
Facesitting glass facesitting guzel american

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/I/4oWIW/Facesitting%20glass%20facesitting%20guzel%20american_cover.jpg) (http://pimpandhost.com/image/65050954)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting glass facesitting guzel american
Runtime : 9min 29s
File Size : 145 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/J/4oWJ0/Facesitting%20glass%20facesitting%20guzel%20american_thumb_0.jpg) (http://pimpandhost.com/image/65050958)

Download Links:

Facesitting glass facesitting guzel american.rar (http://k2s.cc/file/cf6ec8fd42f38)
Title: Facesitting Goddesses Ass Cleaner
Post by: squidmanheis on June 21, 2017, 05:52:11 am
Facesitting Goddesses Ass Cleaner

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/J/4oWJT/Facesitting%20Goddesses%20Ass%20Cleaner_cover.jpg) (http://pimpandhost.com/image/65051013)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Goddesses Ass Cleaner
Runtime : 4min 19s
File Size : 179 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/J/4oWJU/Facesitting%20Goddesses%20Ass%20Cleaner_thumb_0.jpg) (http://pimpandhost.com/image/65051014)

Download Links:

Facesitting Goddesses Ass Cleaner.rar (http://k2s.cc/file/df9ae0d963f7b)
Title: Facesitting Good for Eating Ass
Post by: squidmanheis on June 21, 2017, 08:52:10 am
Facesitting Good for Eating Ass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/L/4oWLc/Facesitting%20Good%20for%20Eating%20Ass_cover.jpg) (http://pimpandhost.com/image/65051094)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Good for Eating Ass
Runtime : 4min 33s
File Size : 186 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/L/4oWLg/Facesitting%20Good%20for%20Eating%20Ass_thumb_0.jpg) (http://pimpandhost.com/image/65051098)

Download Links:

Facesitting Good for Eating Ass.rar (http://k2s.cc/file/e9f6c517a236a)
Title: Facesitting Gorgeous ass of mistress
Post by: squidmanheis on June 21, 2017, 11:52:07 am
Facesitting Gorgeous ass of mistress

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/M/4oWMN/Facesitting%20Gorgeous%20ass%20of%20mistress_cover.jpg) (http://pimpandhost.com/image/65051193)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Gorgeous ass of mistress
Runtime : 11min 12s
File Size : 31.0 MB
File Type: mp4
Resolution : 768x432

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/M/4oWMO/Facesitting%20Gorgeous%20ass%20of%20mistress_thumb_0.jpg) (http://pimpandhost.com/image/65051194)

Download Links:

Facesitting Gorgeous ass of mistress.rar (http://k2s.cc/file/18bbbc31fc7dc)
Title: Facesitting Harremast
Post by: squidmanheis on June 21, 2017, 02:52:06 pm
Facesitting Harremast

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/N/4oWN3/Facesitting%20Harremast_cover.jpg) (http://pimpandhost.com/image/65051209)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Harremast
Runtime : 5min 0s
File Size : 215 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/N/4oWN4/Facesitting%20Harremast_thumb_0.jpg) (http://pimpandhost.com/image/65051210)

Download Links:

Facesitting Harremast.rar (http://k2s.cc/file/e05e39d1b21c5)
Title: Facesitting hot girl fs fs victim
Post by: squidmanheis on June 21, 2017, 05:52:05 pm
Facesitting hot girl fs fs victim

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/O/4oWOS/Facesitting%20hot%20girl%20fs%20fs%20victim_cover.jpg) (http://pimpandhost.com/image/65051322)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting hot girl fs fs victim
Runtime : 11min 51s
File Size : 67.6 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/W/O/4oWOU/Facesitting%20hot%20girl%20fs%20fs%20victim_thumb_0.jpg) (http://pimpandhost.com/image/65051324)

Download Links:

Facesitting hot girl fs fs victim.rar (http://k2s.cc/file/c9d771b371c12)
Title: Facesitting miss kahti in swiss 05
Post by: squidmanheis on June 24, 2017, 12:03:20 am
Facesitting miss kahti in swiss 05

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/k/4oXk8/Facesitting%20miss%20kahti%20in%20swiss%2005_cover.jpg) (http://pimpandhost.com/image/65053260)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting miss kahti in swiss 05
Runtime : 10min 58s
File Size : 157 MB
File Type: wmv
Resolution : 720x576

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/k/4oXkc/Facesitting%20miss%20kahti%20in%20swiss%2005_thumb_0.jpg) (http://pimpandhost.com/image/65053264)

Download Links:

Facesitting miss kahti in swiss 05.rar (http://k2s.cc/file/12362bc2ebe5b)
Title: Facesitting Mistress's Ass Cleaner
Post by: squidmanheis on June 24, 2017, 03:03:16 am
Facesitting Mistress's Ass Cleaner

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/l/4oXlw/Facesitting%20Mistress_s%20Ass%20Cleaner_cover.jpg) (http://pimpandhost.com/image/65053346)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Mistress's Ass Cleaner
Runtime : 5min 57s
File Size : 125 MB
File Type: avi
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/l/4oXlx/Facesitting%20Mistress_s%20Ass%20Cleaner_thumb_0.jpg) (http://pimpandhost.com/image/65053347)

Download Links:

Facesitting Mistress's Ass Cleaner.rar (http://k2s.cc/file/9738bab325dcd)
Title: Facesitting Movie0892CFS Pussy licking 101 Jaelynn, Jean correct AR
Post by: squidmanheis on June 24, 2017, 06:03:18 am
Facesitting Movie0892CFS - Pussy licking 101 Jaelynn, Jean correct AR

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/m/4oXmh/Facesitting%20Movie0892CFS%20-%20Pussy%20licking%20101%20Jaelynn_%20Jean%20correct%20AR_cover.jpg) (http://pimpandhost.com/image/65053393)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Movie0892CFS - Pussy licking 101 Jaelynn, Jean correct AR
Runtime : 7min 31s
File Size : 85.7 MB
File Type: wmv
Resolution : 720x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/m/4oXmm/Facesitting%20Movie0892CFS%20-%20Pussy%20licking%20101%20Jaelynn_%20Jean%20correct%20AR_thumb_0.jpg) (http://pimpandhost.com/image/65053398)

Download Links:

Facesitting Movie0892CFS - Pussy licking 101 Jaelynn, Jean correct AR.rar (http://k2s.cc/file/c31271f8f93b6)
Title: Facesitting Ms Clara and her old dog
Post by: squidmanheis on June 24, 2017, 09:03:14 am
Facesitting Ms Clara and her old dog

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/m/4oXmU/Facesitting%20Ms%20Clara%20and%20her%20old%20dog_cover.jpg) (http://pimpandhost.com/image/65053432)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Ms Clara and her old dog
Runtime : 11min 2s
File Size : 75.6 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/n/4oXn5/Facesitting%20Ms%20Clara%20and%20her%20old%20dog_thumb_0.jpg) (http://pimpandhost.com/image/65053443)

Download Links:

Facesitting Ms Clara and her old dog.rar (http://k2s.cc/file/1bc88a847aae0)
Title: Facesitting my ass and pussy now
Post by: squidmanheis on June 24, 2017, 12:03:14 pm
Facesitting my ass and pussy now

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/n/4oXnB/Facesitting%20my%20ass%20and%20pussy%20now_cover.jpg) (http://pimpandhost.com/image/65053475)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting my ass and pussy now
Runtime : 5min 17s
File Size : 181 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/n/4oXnC/Facesitting%20my%20ass%20and%20pussy%20now_thumb_0.jpg) (http://pimpandhost.com/image/65053476)

Download Links:

Facesitting my ass and pussy now.rar (http://k2s.cc/file/3311c6797b539)
Title: Facesitting Masorotica Face Bouncer 4
Post by: squidmanheis on June 24, 2017, 01:09:25 pm
Facesitting Masorotica - Face Bouncer 4

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/f/4oXfU/Facesitting%20Masorotica%20-%20Face%20Bouncer%204_cover.jpg) (http://pimpandhost.com/image/65052998)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Masorotica - Face Bouncer 4
Runtime : 3min 39s
File Size : 39.6 MB
File Type: wmv
Resolution : 720x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/f/4oXfY/Facesitting%20Masorotica%20-%20Face%20Bouncer%204_thumb_0.jpg) (http://pimpandhost.com/image/65053002)

Download Links:

Facesitting Masorotica - Face Bouncer 4.rar (http://k2s.cc/file/bb01274060c5a)
Title: Facesitting MY Pleasure Comes First
Post by: squidmanheis on June 24, 2017, 03:03:10 pm
Facesitting MY Pleasure Comes First

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/o/4oXoE/Facesitting%20MY%20Pleasure%20Comes%20First_cover.jpg) (http://pimpandhost.com/image/65053540)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting MY Pleasure Comes First
Runtime : 5min 42s
File Size : 125 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/o/4oXoG/Facesitting%20MY%20Pleasure%20Comes%20First_thumb_0.jpg) (http://pimpandhost.com/image/65053542)

Download Links:

Facesitting MY Pleasure Comes First.rar (http://k2s.cc/file/61ee115307531)
Title: Facesitting Na Bob FS 720p
Post by: squidmanheis on June 24, 2017, 06:03:10 pm
Facesitting Na Bob FS 720p

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/p/4oXpF/Facesitting%20Na%20Bob%20FS%20720p_cover.jpg) (http://pimpandhost.com/image/65053603)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Na Bob FS 720p
Runtime : 10min 23s
File Size : 243 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/p/4oXpG/Facesitting%20Na%20Bob%20FS%20720p_thumb_0.jpg) (http://pimpandhost.com/image/65053604)

Download Links:

Facesitting Na Bob FS 720p.rar (http://k2s.cc/file/99fd2b1a86cab)
Post by: squidmanheis on June 24, 2017, 09:03:08 pm

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/t/4oXt9/Facesitting%20OK%20DEPO%20PSYLCK%20EXTRACT_cover.jpg) (http://pimpandhost.com/image/65053819)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting OK DEPO PSYLCK EXTRACT
Runtime : 9min 3s
File Size : 246 MB
File Type: mp4
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/t/4oXte/Facesitting%20OK%20DEPO%20PSYLCK%20EXTRACT_thumb_0.jpg) (http://pimpandhost.com/image/65053824)

Download Links:

Facesitting OK DEPO PSYLCK EXTRACT.rar (http://k2s.cc/file/9049666aa23d9)
Title: Facesitting ok fb cunli
Post by: squidmanheis on June 25, 2017, 03:04:08 am
Facesitting ok fb cunli

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/y/4oXyo/Facesitting%20ok%20fb%20cunli_cover.jpg) (http://pimpandhost.com/image/65054144)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting ok fb cunli
Runtime : 3min 38s
File Size : 55.6 MB
File Type: wmv
Resolution : 720x540

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/y/4oXyp/Facesitting%20ok%20fb%20cunli_thumb_0.jpg) (http://pimpandhost.com/image/65054145)

Download Links:

Facesitting ok fb cunli.rar (http://k2s.cc/file/7f439762dda0d)
Title: Facesitting ok fb ss703 01
Post by: squidmanheis on June 25, 2017, 06:04:07 am
Facesitting ok fb ss703 01

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/y/4oXyM/Facesitting%20ok%20fb%20ss703%2001_cover.jpg) (http://pimpandhost.com/image/65054168)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting ok fb ss703 01
Runtime : 9min 34s
File Size : 72.7 MB
File Type: wmv
Resolution : 640x360

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/y/4oXyR/Facesitting%20ok%20fb%20ss703%2001_thumb_0.jpg) (http://pimpandhost.com/image/65054173)

Download Links:

Facesitting ok fb ss703 01.rar (http://k2s.cc/file/cde36311af9ba)
Title: Facesitting OriasKick punishment
Post by: squidmanheis on June 25, 2017, 09:04:03 am
Facesitting OriasKick punishment

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/z/4oXzp/Facesitting%20OriasKick%20punishment_cover.jpg) (http://pimpandhost.com/image/65054207)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting OriasKick punishment
Runtime : 8min 59s
File Size : 133 MB
File Type: wmv
Resolution : 720x406

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/z/4oXzq/Facesitting%20OriasKick%20punishment_thumb_0.jpg) (http://pimpandhost.com/image/65054208)

Download Links:

Facesitting OriasKick punishment.rar (http://k2s.cc/file/05b886a674662)
Title: Facesitting oto femdom 23
Post by: squidmanheis on June 25, 2017, 12:04:01 pm
Facesitting oto femdom  23

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/A/4oXA2/Facesitting%20oto%20femdom%20%2023_cover.jpg) (http://pimpandhost.com/image/65054246)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting oto femdom  23
Runtime : 6min 49s
File Size : 82.5 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/A/4oXA4/Facesitting%20oto%20femdom%20%2023_thumb_0.jpg) (http://pimpandhost.com/image/65054248)

Download Links:

Facesitting oto femdom  23.rar (http://k2s.cc/file/f62b2778bd11c)
Title: Facesitting paigeturnah
Post by: squidmanheis on June 25, 2017, 03:04:00 pm
Facesitting paigeturnah

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/A/4oXAv/Facesitting%20paigeturnah_cover.jpg) (http://pimpandhost.com/image/65054275)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting paigeturnah
Runtime : 9min 8s
File Size : 140 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/A/4oXAx/Facesitting%20paigeturnah_thumb_0.jpg) (http://pimpandhost.com/image/65054277)

Download Links:

Facesitting paigeturnah.rar (http://k2s.cc/file/c582d107f1ba7)
Title: Facesitting power hungry lady gets hd
Post by: squidmanheis on June 25, 2017, 06:03:58 pm
Facesitting power-hungry-lady-gets-hd

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/B/4oXBr/Facesitting%20power-hungry-lady-gets-hd_cover.jpg) (http://pimpandhost.com/image/65054333)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting power-hungry-lady-gets-hd
Runtime : 5min 4s
File Size : 225 MB
File Type: mp4
Resolution : 1920x1080

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/B/4oXBu/Facesitting%20power-hungry-lady-gets-hd_thumb_0.jpg) (http://pimpandhost.com/image/65054336)

Download Links:

Facesitting power-hungry-lady-gets-hd.rar (http://k2s.cc/file/0e95bec1fa8d4)
Title: Facesitting pussy and ass licking for hairy mature
Post by: squidmanheis on June 25, 2017, 09:03:58 pm
Facesitting pussy and ass licking for hairy mature

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/C/4oXCF/Facesitting%20pussy%20and%20ass%20licking%20for%20hairy%20mature_cover.jpg) (http://pimpandhost.com/image/65054409)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting pussy and ass licking for hairy mature
Runtime : 2min 46s
File Size : 103 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/C/4oXCI/Facesitting%20pussy%20and%20ass%20licking%20for%20hairy%20mature_thumb_0.jpg) (http://pimpandhost.com/image/65054412)

Download Links:

Facesitting pussy and ass licking for hairy mature.rar (http://k2s.cc/file/b2bb0eea9ab61)
Title: Facesitting Pussy service
Post by: squidmanheis on June 26, 2017, 12:03:43 am
Facesitting Pussy service

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/D/4oXDx/Facesitting%20Pussy%20service_cover.jpg) (http://pimpandhost.com/image/65054463)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Pussy service
Runtime : 8min 33s
File Size : 185 MB
File Type: wmv
Resolution : 720x576

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/D/4oXDz/Facesitting%20Pussy%20service_thumb_0.jpg) (http://pimpandhost.com/image/65054465)

Download Links:

Facesitting Pussy service.rar (http://k2s.cc/file/0ac35a6e2e00e)
Title: Facesitting QueenParis Die 360 Grad Facesitting Leck Challenge
Post by: squidmanheis on June 26, 2017, 03:03:42 am
Facesitting QueenParis - Die 360 Grad Facesitting Leck Challenge

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/E/4oXES/Facesitting%20QueenParis%20-%20Die%20360%20Grad%20Facesitting%20Leck%20Challenge%20_cover.jpg) (http://pimpandhost.com/image/65054546)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting QueenParis - Die 360 Grad Facesitting Leck Challenge
Runtime : 6min 42s
File Size : 138 MB
File Type: flv
Resolution : 1920x1080

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/E/4oXET/Facesitting%20QueenParis%20-%20Die%20360%20Grad%20Facesitting%20Leck%20Challenge%20_thumb_0.jpg) (http://pimpandhost.com/image/65054547)

Download Links:

Facesitting QueenParis - Die 360 Grad Facesitting Leck Challenge .rar (http://k2s.cc/file/005b25d9492a4)
Title: Facesitting QueenParis Engste Vagina im Internet sucht Fotzen Lecker
Post by: squidmanheis on June 26, 2017, 06:03:38 am
Facesitting QueenParis - Engste Vagina im Internet sucht Fotzen Lecker

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/G/4oXGJ/Facesitting%20QueenParis%20-%20Engste%20Vagina%20im%20Internet%20sucht%20Fotzen%20Lecker%20_cover.jpg) (http://pimpandhost.com/image/65054661)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting QueenParis - Engste Vagina im Internet sucht Fotzen Lecker
Runtime : 3min 15s
File Size : 52.8 MB
File Type: mp4
Resolution : 1920x1080

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/G/4oXGN/Facesitting%20QueenParis%20-%20Engste%20Vagina%20im%20Internet%20sucht%20Fotzen%20Lecker%20_thumb_0.jpg) (http://pimpandhost.com/image/65054665)

Download Links:

Facesitting QueenParis - Engste Vagina im Internet sucht Fotzen Lecker .rar (http://k2s.cc/file/99668c08b9730)
Title: Facesitting REASlaveforTheBossPantyhoseDominationPART2
Post by: squidmanheis on June 26, 2017, 09:03:37 am
Facesitting REASlaveforTheBossPantyhoseDominationPART2

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/H/4oXHc/Facesitting%20REASlaveforTheBossPantyhoseDominationPART2_cover.jpg) (http://pimpandhost.com/image/65054690)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting REASlaveforTheBossPantyhoseDominationPART2
Runtime : 5min 5s
File Size : 204 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/H/4oXHf/Facesitting%20REASlaveforTheBossPantyhoseDominationPART2_thumb_0.jpg) (http://pimpandhost.com/image/65054693)

Download Links:

Facesitting REASlaveforTheBossPantyhoseDominationPART2.rar (http://k2s.cc/file/e1f5669d54be8)
Title: Facesitting Red Haired Ginger Sits Face
Post by: squidmanheis on June 26, 2017, 12:03:35 pm
Facesitting Red Haired Ginger Sits  Face

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/J/4oXJ6/Facesitting%20Red%20Haired%20Ginger%20Sits%20%20Face%20_cover.jpg) (http://pimpandhost.com/image/65054808)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Red Haired Ginger Sits  Face
Runtime : 10min 1s
File Size : 120 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/J/4oXJ9/Facesitting%20Red%20Haired%20Ginger%20Sits%20%20Face%20_thumb_0.jpg) (http://pimpandhost.com/image/65054811)

Download Links:

Facesitting Red Haired Ginger Sits  Face .rar (http://k2s.cc/file/f064c3937611f)
Title: Facesitting red head facesitting
Post by: squidmanheis on June 26, 2017, 03:03:36 pm
Facesitting red head facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/K/4oXK6/Facesitting%20red%20head%20facesitting_cover.jpg) (http://pimpandhost.com/image/65054870)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting red head facesitting
Runtime : 7min 0s
File Size : 97.2 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/K/4oXKa/Facesitting%20red%20head%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/65054874)

Download Links:

Facesitting red head facesitting.rar (http://k2s.cc/file/8a9231aad9b52)
Title: Facesitting red panty ass under
Post by: squidmanheis on June 26, 2017, 06:03:34 pm
Facesitting red panty ass under

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/L/4oXL5/Facesitting%20red%20panty%20ass%20under_cover.jpg) (http://pimpandhost.com/image/65054931)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting red panty ass under
Runtime : 8min 10s
File Size : 125 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/L/4oXLa/Facesitting%20red%20panty%20ass%20under_thumb_0.jpg) (http://pimpandhost.com/image/65054936)

Download Links:

Facesitting red panty ass under.rar (http://k2s.cc/file/442c2f3919033)
Title: Facesitting Riley Ried as
Post by: squidmanheis on June 26, 2017, 09:03:42 pm
Facesitting Riley Ried  as

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/L/4oXLY/Facesitting%20Riley%20Ried%20%20as_cover.jpg) (http://pimpandhost.com/image/65054986)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Riley Ried  as
Runtime : 8min 7s
File Size : 108 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/M/4oXM4/Facesitting%20Riley%20Ried%20%20as_thumb_0.jpg) (http://pimpandhost.com/image/65054992)

Download Links:

Facesitting Riley Ried  as.rar (http://k2s.cc/file/be10126831777)
Title: Facesitting Russian facesitting and footworship
Post by: squidmanheis on June 27, 2017, 12:03:31 am
Facesitting Russian facesitting and footworship

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/M/4oXMU/Facesitting%20Russian%20facesitting%20and%20footworship_cover.jpg) (http://pimpandhost.com/image/65055044)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Russian facesitting and footworship
Runtime : 4min 46s
File Size : 72.2 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/M/4oXMV/Facesitting%20Russian%20facesitting%20and%20footworship_thumb_0.jpg) (http://pimpandhost.com/image/65055045)

Download Links:

Facesitting Russian facesitting and footworship.rar (http://k2s.cc/file/127e962b1d8ee)
Title: Facesitting s463zoeyportlandpart2
Post by: squidmanheis on June 27, 2017, 03:03:29 am
Facesitting s463zoeyportlandpart2

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/N/4oXNB/Facesitting%20s463zoeyportlandpart2_cover.jpg) (http://pimpandhost.com/image/65055087)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting s463zoeyportlandpart2
Runtime : 6min 24s
File Size : 237 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/N/4oXND/Facesitting%20s463zoeyportlandpart2_thumb_0.jpg) (http://pimpandhost.com/image/65055089)

Download Links:

Facesitting s463zoeyportlandpart2.rar (http://k2s.cc/file/d4f1ed39e2227)
Title: Facesitting sashacuck3
Post by: squidmanheis on June 27, 2017, 06:03:27 am
Facesitting sashacuck3

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/Q/4oXQS/Facesitting%20sashacuck3_cover.jpg) (http://pimpandhost.com/image/65055290)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting sashacuck3
Runtime : 6min 34s
File Size : 102 MB
File Type: wmv
Resolution : 960x540

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/Q/4oXQW/Facesitting%20sashacuck3_thumb_0.jpg) (http://pimpandhost.com/image/65055294)

Download Links:

Facesitting sashacuck3.rar (http://k2s.cc/file/a4f45d67bc564)
Title: Facesitting sashacuckpt1
Post by: squidmanheis on June 27, 2017, 09:03:26 am
Facesitting sashacuckpt1


Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting sashacuckpt1
Runtime : 6min 52s
File Size : 265 MB
File Type: wmv
Resolution : 1920x1080


Download Links:

Facesitting sashacuckpt1.rar (http://k2s.cc/file/eb3d49e6722ba)
Title: Facesitting SavannaGinger ep01
Post by: squidmanheis on June 27, 2017, 12:03:26 pm
Facesitting SavannaGinger-ep01

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/T/4oXTi/Facesitting%20SavannaGinger-ep01%20_cover.jpg) (http://pimpandhost.com/image/65055440)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting SavannaGinger-ep01
Runtime : 4min 23s
File Size : 191 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/T/4oXTl/Facesitting%20SavannaGinger-ep01%20_thumb_0.jpg) (http://pimpandhost.com/image/65055443)

Download Links:

Facesitting SavannaGinger-ep01 .rar (http://k2s.cc/file/55c6c69f80b7f)
Title: Facesitting Saving Our Marriage 2 Part 1
Post by: squidmanheis on June 27, 2017, 03:03:25 pm
Facesitting Saving Our Marriage 2 Part 1

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/V/4oXV4/Facesitting%20Saving%20Our%20Marriage%202%20Part%201_cover.jpg) (http://pimpandhost.com/image/65055550)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Saving Our Marriage 2 Part 1
Runtime : 6min 27s
File Size : 215 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/V/4oXV8/Facesitting%20Saving%20Our%20Marriage%202%20Part%201_thumb_0.jpg) (http://pimpandhost.com/image/65055554)

Download Links:

Facesitting Saving Our Marriage 2 Part 1.rar (http://k2s.cc/file/372722ec5bf81)
Title: Facesitting sh 02 26 13 minimovie part1
Post by: squidmanheis on June 27, 2017, 09:03:21 pm
Facesitting sh 02 26 13 minimovie part1

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/W/4oXWZ/Facesitting%20sh%2002%2026%2013%20minimovie%20part1_cover.jpg) (http://pimpandhost.com/image/65055669)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting sh 02 26 13 minimovie part1
Runtime : 5min 47s
File Size : 90.0 MB
File Type: wmv
Resolution : 960x540

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/X/4oXX0/Facesitting%20sh%2002%2026%2013%20minimovie%20part1_thumb_0.jpg) (http://pimpandhost.com/image/65055670)

Download Links:

Facesitting sh 02 26 13 minimovie part1.rar (http://k2s.cc/file/29a266a55d729)
Title: Facesitting Slave Face Farting
Post by: squidmanheis on June 28, 2017, 12:03:22 am
Facesitting Slave Face Farting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/X/4oXXB/Facesitting%20Slave%20Face%20Farting_cover.jpg) (http://pimpandhost.com/image/65055707)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Slave Face Farting
Runtime : 9min 54s
File Size : 126 MB
File Type: wmv
Resolution : 640x360

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/X/4oXXC/Facesitting%20Slave%20Face%20Farting_thumb_0.jpg) (http://pimpandhost.com/image/65055708)

Download Links:

Facesitting Slave Face Farting.rar (http://k2s.cc/file/464d0a87fdbcf)
Title: Facesitting Slave Rider
Post by: squidmanheis on June 28, 2017, 03:03:30 am
Facesitting Slave Rider

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/Y/4oXYG/Facesitting%20Slave%20Rider_cover.jpg) (http://pimpandhost.com/image/65055774)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Slave Rider
Runtime : 6min 40s
File Size : 185 MB
File Type: wmv
Resolution : 720x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/X/Y/4oXYM/Facesitting%20Slave%20Rider_thumb_0.jpg) (http://pimpandhost.com/image/65055780)

Download Links:

Facesitting Slave Rider.rar (http://k2s.cc/file/fc3329dfe61af)
Title: Facesitting Smother your face and eat my asshole
Post by: squidmanheis on June 28, 2017, 06:03:16 am
Facesitting Smother your face and eat my asshole

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/0/4oY0C/Facesitting%20Smother%20your%20face%20and%20eat%20my%20asshole_cover.jpg) (http://pimpandhost.com/image/65055894)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Smother your face and eat my asshole
Runtime : 5min 24s
File Size : 57.3 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/0/4oY0L/Facesitting%20Smother%20your%20face%20and%20eat%20my%20asshole_thumb_0.jpg) (http://pimpandhost.com/image/65055903)

Download Links:

Facesitting Smother your face and eat my asshole.rar (http://k2s.cc/file/a11f92fc263db)
Title: Facesitting Smothered Hope
Post by: squidmanheis on June 28, 2017, 09:03:15 am
Facesitting Smothered Hope

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/3/4oY3j/Facesitting%20Smothered%20Hope_cover.jpg) (http://pimpandhost.com/image/65056061)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Smothered Hope
Runtime : 10min 34s
File Size : 282 MB
File Type: wmv
Resolution : 720x576

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/3/4oY3k/Facesitting%20Smothered%20Hope_thumb_0.jpg) (http://pimpandhost.com/image/65056062)

Download Links:

Facesitting Smothered Hope.rar (http://k2s.cc/file/b2a2cbca6da57)
Title: Facesitting Smothered 'n Covered by a Gigantic Ass
Post by: squidmanheis on June 28, 2017, 12:03:16 pm
Facesitting Smothered 'n Covered by a Gigantic Ass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/1/4oY1m/Facesitting%20Smothered%20_n%20Covered%20by%20a%20Gigantic%20Ass_cover.jpg) (http://pimpandhost.com/image/65055940)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Smothered 'n Covered by a Gigantic Ass
Runtime : 4min 29s
File Size : 197 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/1/4oY1o/Facesitting%20Smothered%20_n%20Covered%20by%20a%20Gigantic%20Ass_thumb_0.jpg) (http://pimpandhost.com/image/65055942)

Download Links:

Facesitting Smothered 'n Covered by a Gigantic Ass.rar (http://k2s.cc/file/2c7090af95f28)
Title: Facesitting SN JeanBardotSweatyFtPartyFtedClean2 HD
Post by: squidmanheis on June 28, 2017, 03:03:13 pm
Facesitting SN JeanBardotSweatyFtPartyFtedClean2-HD

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/5/4oY5z/Facesitting%20SN%20JeanBardotSweatyFtPartyFtedClean2-HD_cover.jpg) (http://pimpandhost.com/image/65056201)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting SN JeanBardotSweatyFtPartyFtedClean2-HD
Runtime : 5min 1s
File Size : 83.4 MB
File Type: wmv
Resolution : 864x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/5/4oY5C/Facesitting%20SN%20JeanBardotSweatyFtPartyFtedClean2-HD_thumb_0.jpg) (http://pimpandhost.com/image/65056204)

Download Links:

Facesitting SN JeanBardotSweatyFtPartyFtedClean2-HD.rar (http://k2s.cc/file/7a07ef73c2d51)
Title: Facesitting Sorry your hurt but you still have to clean my ass
Post by: squidmanheis on June 28, 2017, 06:03:10 pm
Facesitting Sorry your hurt but you still have to clean my ass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/6/4oY66/Facesitting%20Sorry%20your%20hurt%20but%20you%20still%20have%20to%20clean%20my%20ass_cover.jpg) (http://pimpandhost.com/image/65056234)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Sorry your hurt but you still have to clean my ass
Runtime : 11min 3s
File Size : 118 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/6/4oY6c/Facesitting%20Sorry%20your%20hurt%20but%20you%20still%20have%20to%20clean%20my%20ass_thumb_0.jpg) (http://pimpandhost.com/image/65056240)

Download Links:

Facesitting Sorry your hurt but you still have to clean my ass.rar (http://k2s.cc/file/afc740e703c19)
Title: Facesitting ss397
Post by: squidmanheis on June 28, 2017, 09:03:07 pm
Facesitting ss397

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/7/4oY74/Facesitting%20ss397_cover.jpg) (http://pimpandhost.com/image/65056294)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting ss397
Runtime : 12min 13s
File Size : 262 MB
File Type: mp4
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/7/4oY77/Facesitting%20ss397_thumb_0.jpg) (http://pimpandhost.com/image/65056297)

Download Links:

Facesitting ss397.rar (http://k2s.cc/file/ed052cb509ea6)
Title: Facesitting Study Break
Post by: squidmanheis on June 29, 2017, 12:03:07 am
Facesitting Study Break

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/a/4oYaj/Facesitting%20Study%20Break_cover.jpg) (http://pimpandhost.com/image/65056495)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Study Break
Runtime : 6min 39s
File Size : 107 MB
File Type: wmv
Resolution : 720x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/a/4oYam/Facesitting%20Study%20Break_thumb_0.jpg) (http://pimpandhost.com/image/65056498)

Download Links:

Facesitting Study Break.rar (http://k2s.cc/file/728962e125c0b)
Title: Facesitting super ass blonde girl
Post by: squidmanheis on June 29, 2017, 03:03:05 am
Facesitting super ass blonde girl

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/a/4oYaQ/Facesitting%20super%20ass%20blonde%20girl%20_cover.jpg) (http://pimpandhost.com/image/65056528)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting super ass blonde girl
Runtime : 8min 4s
File Size : 124 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/a/4oYaR/Facesitting%20super%20ass%20blonde%20girl%20_thumb_0.jpg) (http://pimpandhost.com/image/65056529)

Download Links:

Facesitting super ass blonde girl .rar (http://k2s.cc/file/498f3962d457b)
Title: Facesitting Sweaty Sniffing Smother Pt1
Post by: squidmanheis on June 29, 2017, 06:03:05 am
Facesitting Sweaty Sniffing Smother Pt1

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/b/4oYbO/Facesitting%20Sweaty%20Sniffing%20Smother%20Pt1_cover.jpg) (http://pimpandhost.com/image/65056588)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Sweaty Sniffing Smother Pt1
Runtime : 10min 11s
File Size : 232 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/b/4oYbQ/Facesitting%20Sweaty%20Sniffing%20Smother%20Pt1_thumb_0.jpg) (http://pimpandhost.com/image/65056590)

Download Links:

Facesitting Sweaty Sniffing Smother Pt1.rar (http://k2s.cc/file/79d0c7a52dd99)
Title: Facesitting Sweaty Sniffing Smother Pt2
Post by: squidmanheis on June 29, 2017, 09:03:02 am
Facesitting Sweaty Sniffing Smother Pt2

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/d/4oYdw/Facesitting%20Sweaty%20Sniffing%20Smother%20Pt2_cover.jpg) (http://pimpandhost.com/image/65056694)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Sweaty Sniffing Smother Pt2
Runtime : 10min 28s
File Size : 240 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/d/4oYdx/Facesitting%20Sweaty%20Sniffing%20Smother%20Pt2_thumb_0.jpg) (http://pimpandhost.com/image/65056695)

Download Links:

Facesitting Sweaty Sniffing Smother Pt2.rar (http://k2s.cc/file/c384387e5e11c)
Title: Facesitting the great outdoors pussy licking
Post by: squidmanheis on June 29, 2017, 12:03:02 pm
Facesitting the great outdoors pussy licking

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/f/4oYff/Facesitting%20the%20great%20outdoors%20pussy%20licking_cover.jpg) (http://pimpandhost.com/image/65056801)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting the great outdoors pussy licking
Runtime : 5min 51s
File Size : 154 MB
File Type: wmv
Resolution : 720x576

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/f/4oYfj/Facesitting%20the%20great%20outdoors%20pussy%20licking_thumb_0.jpg) (http://pimpandhost.com/image/65056805)

Download Links:

Facesitting the great outdoors pussy licking.rar (http://k2s.cc/file/d76f234042a12)
Title: Facesitting tinkerbell
Post by: squidmanheis on June 29, 2017, 03:03:00 pm
Facesitting tinkerbell

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/g/4oYgH/Facesitting%20tinkerbell_cover.jpg) (http://pimpandhost.com/image/65056891)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting tinkerbell
Runtime : 11min 20s
File Size : 167 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/g/4oYgJ/Facesitting%20tinkerbell_thumb_0.jpg) (http://pimpandhost.com/image/65056893)

Download Links:

Facesitting tinkerbell.rar (http://k2s.cc/file/f90a7af7a6eeb)
Title: Facesitting Torian p1
Post by: squidmanheis on June 29, 2017, 06:02:57 pm
Facesitting Torian p1

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/h/4oYhH/Facesitting%20Torian%20p1_cover.jpg) (http://pimpandhost.com/image/65056953)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Torian p1
Runtime : 10min 40s
File Size : 145 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/h/4oYhJ/Facesitting%20Torian%20p1_thumb_0.jpg) (http://pimpandhost.com/image/65056955)

Download Links:

Facesitting Torian p1.rar (http://k2s.cc/file/a0c6ff6f21d36)
Title: Facesitting Torian p3
Post by: squidmanheis on June 29, 2017, 09:02:55 pm
Facesitting Torian p3

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/i/4oYil/Facesitting%20Torian%20p3_cover.jpg) (http://pimpandhost.com/image/65056993)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Torian p3
Runtime : 9min 5s
File Size : 122 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/i/4oYin/Facesitting%20Torian%20p3_thumb_0.jpg) (http://pimpandhost.com/image/65056995)

Download Links:

Facesitting Torian p3.rar (http://k2s.cc/file/dc71f75c189db)
Title: Facesitting Torian p4
Post by: squidmanheis on June 30, 2017, 12:02:52 am
Facesitting Torian p4

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/j/4oYjg/Facesitting%20Torian%20p4_cover.jpg) (http://pimpandhost.com/image/65057050)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Torian p4
Runtime : 10min 2s
File Size : 136 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/j/4oYjj/Facesitting%20Torian%20p4_thumb_0.jpg) (http://pimpandhost.com/image/65057053)

Download Links:

Facesitting Torian p4.rar (http://k2s.cc/file/bbcc30eb40f2c)
Title: Facesitting Tristan's Ass Bitch
Post by: squidmanheis on June 30, 2017, 03:02:54 am
Facesitting Tristan's Ass Bitch

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/k/4oYki/Facesitting%20Tristan_s%20Ass%20Bitch_cover.jpg) (http://pimpandhost.com/image/65057114)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Tristan's Ass Bitch
Runtime : 6min 32s
File Size : 147 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/k/4oYkj/Facesitting%20Tristan_s%20Ass%20Bitch_thumb_0.jpg) (http://pimpandhost.com/image/65057115)

Download Links:

Facesitting Tristan's Ass Bitch.rar (http://k2s.cc/file/eaf940eaeab97)
Title: Facesitting TrueFSOrg postato
Post by: squidmanheis on June 30, 2017, 06:02:52 am
Facesitting TrueFSOrg postato

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/l/4oYla/Facesitting%20TrueFSOrg%20postato_cover.jpg) (http://pimpandhost.com/image/65057168)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting TrueFSOrg postato
Runtime : 5min 53s
File Size : 43.9 MB
File Type: wmv
Resolution : 720x576

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/l/4oYlc/Facesitting%20TrueFSOrg%20postato_thumb_0.jpg) (http://pimpandhost.com/image/65057170)

Download Links:

Facesitting TrueFSOrg postato.rar (http://k2s.cc/file/80dbf4e78476a)
Title: Facesitting two bitches against a guy
Post by: squidmanheis on June 30, 2017, 09:02:49 am
Facesitting two bitches against a guy

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/l/4oYlx/Facesitting%20two%20bitches%20against%20a%20guy_cover.jpg) (http://pimpandhost.com/image/65057191)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting two bitches against a guy
Runtime : 7min 21s
File Size : 136 MB
File Type: mp4
Resolution : 854x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/l/4oYlC/Facesitting%20two%20bitches%20against%20a%20guy_thumb_0.jpg) (http://pimpandhost.com/image/65057196)

Download Links:

Facesitting two bitches against a guy.rar (http://k2s.cc/file/5a978b9927120)
Title: Facesitting ultimate ass smother
Post by: squidmanheis on June 30, 2017, 12:02:47 pm
Facesitting ultimate ass smother

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/m/4oYmt/Facesitting%20ultimate%20ass%20smother_cover.jpg) (http://pimpandhost.com/image/65057249)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting ultimate ass smother
Runtime : 7min 9s
File Size : 193 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/m/4oYmv/Facesitting%20ultimate%20ass%20smother_thumb_0.jpg) (http://pimpandhost.com/image/65057251)

Download Links:

Facesitting ultimate ass smother.rar (http://k2s.cc/file/40050107fa4b3)
Title: Facesitting underwater panic stricken full
Post by: squidmanheis on July 02, 2017, 12:07:07 pm
Facesitting underwater panic-stricken full

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/o/4oYo8/Facesitting%20underwater%20panic-stricken%20full_cover.jpg) (http://pimpandhost.com/image/65057352)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting underwater panic-stricken full
Runtime : 11min 15s
File Size : 165 MB
File Type: wmv
Resolution : 768x576

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/o/4oYoc/Facesitting%20underwater%20panic-stricken%20full_thumb_0.jpg) (http://pimpandhost.com/image/65057356)

Download Links:

Facesitting underwater panic-stricken full.rar (http://k2s.cc/file/7d6b9dbbd5d20)
Title: Facesitting 000295
Post by: squidmanheis on July 02, 2017, 02:40:14 pm
Facesitting 000295

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/Q/4oTQ0/Facesitting%20000295_cover.jpg) (http://pimpandhost.com/image/65039860)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting 000295
Runtime : 6min 49s
File Size : 122 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/T/Q/4oTQ6/Facesitting%20000295_thumb_0.jpg) (http://pimpandhost.com/image/65039866)

Download Links:

Facesitting 000295.rar (http://k2s.cc/file/5b440fa2d14d9)
Title: Facesitting video 2 1 face2
Post by: squidmanheis on July 02, 2017, 07:04:14 pm
Facesitting video 2-1 face2

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/p/4oYpi/Facesitting%20video%202-1%20face2_cover.jpg) (http://pimpandhost.com/image/65057424)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting video 2-1 face2
Runtime : 6min 14s
File Size : 92.5 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/p/4oYpo/Facesitting%20video%202-1%20face2_thumb_0.jpg) (http://pimpandhost.com/image/65057430)

Download Links:

Facesitting video 2-1 face2.rar (http://k2s.cc/file/175bf1a309e7a)
Title: Facesitting Whatever I Say Part 4
Post by: squidmanheis on July 02, 2017, 10:08:00 pm
Facesitting Whatever I Say Part 4

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/q/4oYq0/Facesitting%20Whatever%20I%20Say%20Part%204_cover.jpg) (http://pimpandhost.com/image/65057468)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting Whatever I Say Part 4
Runtime : 5min 28s
File Size : 182 MB
File Type: wmv
Resolution : 1280x720

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/o/Y/q/4oYq2/Facesitting%20Whatever%20I%20Say%20Part%204_thumb_0.jpg) (http://pimpandhost.com/image/65057470)

Download Links:

Facesitting Whatever I Say Part 4.rar (http://k2s.cc/file/6e8a2edd574e1)
Title: Facesitting Bitches Neighbourhood Watch
Post by: squidmanheis on July 05, 2017, 06:44:01 pm
Facesitting Bitches - Neighbourhood Watch

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/1/4cO14/Facesitting%20Bitches%20-%20Neighbourhood%20Watch_cover.jpg) (http://pimpandhost.com/image/62157546)


File Name : Facesitting Bitches - Neighbourhood Watch
Runtime : 30min 33s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/1/4cO16/Facesitting%20Bitches%20-%20Neighbourhood%20Watch_thumb_0.jpg) (http://pimpandhost.com/image/62157548)

Download Links:

Facesitting Bitches - Neighbourhood Watch.rar (http://k2s.cc/file/3970dac11158f)
Title: Facesitting Bitches Pay Up
Post by: squidmanheis on July 05, 2017, 07:45:02 pm
Facesitting Bitches - Pay Up

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/B/4gDBQ/Facesitting%20Bitches%20-%20Pay%20Up_cover.jpg) (http://pimpandhost.com/image/63070854)


File Name : Facesitting Bitches - Pay Up
Runtime : 31min 14s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/B/4gDBV/Facesitting%20Bitches%20-%20Pay%20Up_thumb_0.jpg) (http://pimpandhost.com/image/63070859)

Download Links:

Facesitting Bitches - Pay Up.rar (http://k2s.cc/file/4acfa354f3040)
Title: Facesitting Bitches Pole Dancer
Post by: squidmanheis on July 05, 2017, 10:17:25 pm
Facesitting Bitches - Pole Dancer

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/9/4cO9L/Facesitting%20Bitches%20-%20Pole%20Dancer_cover.jpg) (http://pimpandhost.com/image/62158085)


File Name : Facesitting Bitches - Pole Dancer
Runtime : 30min 41s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/9/4cO9O/Facesitting%20Bitches%20-%20Pole%20Dancer_thumb_0.jpg) (http://pimpandhost.com/image/62158088)

Download Links:

Facesitting Bitches - Pole Dancer.rar (http://k2s.cc/file/ab4cb65d38597)
Title: Facesitting Bitches Pressed Flat
Post by: squidmanheis on July 06, 2017, 01:17:25 am
Facesitting Bitches - Pressed Flat

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/e/4cOe9/Facesitting%20Bitches%20-%20Pressed%20Flat_cover.jpg) (http://pimpandhost.com/image/62158357)


File Name : Facesitting Bitches - Pressed Flat
Runtime : 29min 33s
File Size : 165 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/e/4cOeb/Facesitting%20Bitches%20-%20Pressed%20Flat_thumb_0.jpg) (http://pimpandhost.com/image/62158359)

Download Links:

Facesitting Bitches - Pressed Flat.rar (http://k2s.cc/file/1eb357472b90f)
Title: Facesitting Bitches Pretty in Pink
Post by: squidmanheis on July 06, 2017, 04:17:25 am
Facesitting Bitches - Pretty in Pink

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/h/4cOhH/Facesitting%20Bitches%20-%20Pretty%20in%20Pink_cover.jpg) (http://pimpandhost.com/image/62158577)


File Name : Facesitting Bitches - Pretty in Pink
Runtime : 30min 42s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/h/4cOhN/Facesitting%20Bitches%20-%20Pretty%20in%20Pink_thumb_0.jpg) (http://pimpandhost.com/image/62158583)

Download Links:

Facesitting Bitches - Pretty in Pink.rar (http://k2s.cc/file/cd30173bff640)
Title: Facesitting Bitches Rude Santa
Post by: squidmanheis on July 06, 2017, 07:17:21 am
Facesitting Bitches - Rude Santa

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/O/4gDOE/Facesitting%20Bitches%20-%20Rude%20Santa_cover.jpg) (http://pimpandhost.com/image/63071648)


File Name : Facesitting Bitches - Rude Santa
Runtime : 31min 18s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/D/O/4gDOJ/Facesitting%20Bitches%20-%20Rude%20Santa_thumb_0.jpg) (http://pimpandhost.com/image/63071653)

Download Links:

Facesitting Bitches - Rude Santa.rar (http://k2s.cc/file/4fb13f2630f82)
Title: Facesitting Bitches Show Me Your Ass
Post by: squidmanheis on July 06, 2017, 10:18:21 am
Facesitting Bitches - Show Me Your Ass

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/P/4cOPr/Facesitting%20Bitches%20-%20Show%20Me%20Your%20Ass_cover.jpg) (http://pimpandhost.com/image/62160669)


File Name : Facesitting Bitches - Show Me Your Ass
Runtime : 30min 43s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/P/4cOPu/Facesitting%20Bitches%20-%20Show%20Me%20Your%20Ass_thumb_0.jpg) (http://pimpandhost.com/image/62160672)

Download Links:

Facesitting Bitches - Show Me Your Ass.rar (http://k2s.cc/file/cf29a2fdd7a27)
Title: Facesitting Bitches Show Me Your Ass
Post by: squidmanheis on July 06, 2017, 10:18:25 am
Facesitting Bitches - Show Me Your Ass

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/P/4cOPr/Facesitting%20Bitches%20-%20Show%20Me%20Your%20Ass_cover.jpg) (http://pimpandhost.com/image/62160669)


File Name : Facesitting Bitches - Show Me Your Ass
Runtime : 30min 43s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/P/4cOPu/Facesitting%20Bitches%20-%20Show%20Me%20Your%20Ass_thumb_0.jpg) (http://pimpandhost.com/image/62160672)

Download Links:

Facesitting Bitches - Show Me Your Ass.rar (http://k2s.cc/file/cf29a2fdd7a27)
Title: Facesitting Bitches Sitting Room Smother
Post by: squidmanheis on July 06, 2017, 01:17:18 pm
Facesitting Bitches - Sitting Room Smother

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/W/4cOWL/Facesitting%20Bitches%20-%20Sitting%20Room%20Smother_cover.jpg) (http://pimpandhost.com/image/62161123)


File Name : Facesitting Bitches - Sitting Room Smother
Runtime : 30min 9s
File Size : 169 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/O/W/4cOWN/Facesitting%20Bitches%20-%20Sitting%20Room%20Smother_thumb_0.jpg) (http://pimpandhost.com/image/62161125)

Download Links:

Facesitting Bitches - Sitting Room Smother.rar (http://k2s.cc/file/88221df9ded02)
Title: Facesitting Bitches Smother Panties
Post by: squidmanheis on July 06, 2017, 04:17:18 pm
Facesitting Bitches - Smother Panties

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/r/4cPrP/Facesitting%20Bitches%20-%20Smother%20Panties_cover.jpg) (http://pimpandhost.com/image/62163049)


File Name : Facesitting Bitches - Smother Panties
Runtime : 30min 16s
File Size : 170 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/r/4cPrR/Facesitting%20Bitches%20-%20Smother%20Panties_thumb_0.jpg) (http://pimpandhost.com/image/62163051)

Download Links:

Facesitting Bitches - Smother Panties.rar (http://k2s.cc/file/6473df59a63ac)
Title: Facesitting Bitches Sniff it, Slave
Post by: squidmanheis on July 06, 2017, 07:17:16 pm
Facesitting Bitches - Sniff it, Slave

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/z/4cPz3/Facesitting%20Bitches%20-%20Sniff%20it_%20Slave_cover.jpg) (http://pimpandhost.com/image/62163497)


File Name : Facesitting Bitches - Sniff it, Slave
Runtime : 30min 57s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/z/4cPzW/Facesitting%20Bitches%20-%20Sniff%20it_%20Slave_thumb_0.jpg) (http://pimpandhost.com/image/62163552)

Download Links:

Facesitting Bitches - Sniff it, Slave.rar (http://k2s.cc/file/415d5ec608f7a)
Title: Facesitting Bitches Squashed By Scarlet
Post by: squidmanheis on July 06, 2017, 10:17:15 pm
Facesitting Bitches - Squashed By Scarlet

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/T/4cPTe/Facesitting%20Bitches%20-%20Squashed%20By%20Scarlet_cover.jpg) (http://pimpandhost.com/image/62164748)


File Name : Facesitting Bitches - Squashed By Scarlet
Runtime : 30min 29s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/P/T/4cPTf/Facesitting%20Bitches%20-%20Squashed%20By%20Scarlet_thumb_0.jpg) (http://pimpandhost.com/image/62164749)

Download Links:

Facesitting Bitches - Squashed By Scarlet.rar (http://k2s.cc/file/d58319673da9a)
Title: Facesitting Bitches Sunshine Smotherbox
Post by: squidmanheis on July 07, 2017, 01:17:12 am
Facesitting Bitches - Sunshine Smotherbox

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/8/4gE8J/Facesitting%20Bitches%20-%20Sunshine%20Smotherbox_cover.jpg) (http://pimpandhost.com/image/63072893)


File Name : Facesitting Bitches - Sunshine Smotherbox
Runtime : 31min 11s
File Size : 175 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/8/4gE8R/Facesitting%20Bitches%20-%20Sunshine%20Smotherbox_thumb_0.jpg) (http://pimpandhost.com/image/63072901)

Download Links:

Facesitting Bitches - Sunshine Smotherbox.rar (http://k2s.cc/file/6d300f7eda0eb)
Title: Facesitting Bitches That Friday Feeling
Post by: squidmanheis on July 07, 2017, 04:17:11 am
Facesitting Bitches - That Friday Feeling

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/8/4cQ8P/Facesitting%20Bitches%20-%20That%20Friday%20Feeling_cover.jpg) (http://pimpandhost.com/image/62165715)


File Name : Facesitting Bitches - That Friday Feeling
Runtime : 31min 6s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/9/4cQ9J/Facesitting%20Bitches%20-%20That%20Friday%20Feeling_thumb_0.jpg) (http://pimpandhost.com/image/62165771)

Download Links:

Facesitting Bitches - That Friday Feeling.rar (http://k2s.cc/file/60d7af16b365b)
Title: Facesitting Bitches The Bondage Salesman
Post by: squidmanheis on July 07, 2017, 07:17:08 am
Facesitting Bitches - The Bondage Salesman

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/g/4cQgg/Facesitting%20Bitches%20-%20The%20Bondage%20Salesman_cover.jpg) (http://pimpandhost.com/image/62166176)


File Name : Facesitting Bitches - The Bondage Salesman
Runtime : 31min 1s
File Size : 174 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/g/4cQgk/Facesitting%20Bitches%20-%20The%20Bondage%20Salesman_thumb_0.jpg) (http://pimpandhost.com/image/62166180)

Download Links:

Facesitting Bitches - The Bondage Salesman.rar (http://k2s.cc/file/8be2e69bce3f9)
Title: Facesitting Bitches The Book Worm
Post by: squidmanheis on July 07, 2017, 10:17:09 am
Facesitting Bitches - The Book Worm

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/i/4gEi9/Facesitting%20Bitches%20-%20The%20Book%20Worm_cover.jpg) (http://pimpandhost.com/image/63073477)


File Name : Facesitting Bitches - The Book Worm
Runtime : 32min 55s
File Size : 184 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/i/4gEib/Facesitting%20Bitches%20-%20The%20Book%20Worm_thumb_0.jpg) (http://pimpandhost.com/image/63073479)

Download Links:

Facesitting Bitches - The Book Worm.rar (http://k2s.cc/file/427d4de387447)
Title: Facesitting Bitches The Bosss Bottom
Post by: squidmanheis on July 07, 2017, 01:17:21 pm
Facesitting Bitches - The Bosss Bottom

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/g/4cQgQ/Facesitting%20Bitches%20-%20The%20Bosss%20Bottom_cover.jpg) (http://pimpandhost.com/image/62166212)


File Name : Facesitting Bitches - The Bosss Bottom
Runtime : 30min 51s
File Size : 173 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/g/4cQgS/Facesitting%20Bitches%20-%20The%20Bosss%20Bottom_thumb_0.jpg) (http://pimpandhost.com/image/62166214)

Download Links:

Facesitting Bitches - The Bosss Bottom.rar (http://k2s.cc/file/1d2f0c471d67a)
Title: Facesitting Bitches The Counting Game
Post by: squidmanheis on July 07, 2017, 04:17:04 pm
Facesitting Bitches - The Counting Game

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/h/4cQhs/Facesitting%20Bitches%20-%20The%20Counting%20Game_cover.jpg) (http://pimpandhost.com/image/62166250)


File Name : Facesitting Bitches - The Counting Game
Runtime : 30min 40s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/h/4cQhu/Facesitting%20Bitches%20-%20The%20Counting%20Game_thumb_0.jpg) (http://pimpandhost.com/image/62166252)

Download Links:

Facesitting Bitches - The Counting Game.rar (http://k2s.cc/file/f539d4a51315d)
Title: Facesitting Bitches The Hitchhiker
Post by: squidmanheis on July 07, 2017, 07:17:04 pm
Facesitting Bitches - The Hitchhiker

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/k/4cQkr/Facesitting%20Bitches%20-%20The%20Hitchhiker_cover.jpg) (http://pimpandhost.com/image/62166435)


File Name : Facesitting Bitches - The Hitchhiker
Runtime : 29min 58s
File Size : 168 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/k/4cQks/Facesitting%20Bitches%20-%20The%20Hitchhiker_thumb_0.jpg) (http://pimpandhost.com/image/62166436)

Download Links:

Facesitting Bitches - The Hitchhiker.rar (http://k2s.cc/file/f06254fbc9fdd)
Title: Facesitting Bitches The Knicker Tester
Post by: squidmanheis on July 07, 2017, 10:17:03 pm
Facesitting Bitches - The Knicker Tester

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/k/4cQkY/Facesitting%20Bitches%20-%20The%20Knicker%20Tester_cover.jpg) (http://pimpandhost.com/image/62166468)


File Name : Facesitting Bitches - The Knicker Tester
Runtime : 26min 36s
File Size : 149 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/k/4cQkZ/Facesitting%20Bitches%20-%20The%20Knicker%20Tester_thumb_0.jpg) (http://pimpandhost.com/image/62166469)

Download Links:

Facesitting Bitches - The Knicker Tester.rar (http://k2s.cc/file/86a842c07eaf3)
Title: Facesitting Bitches The Office Geek
Post by: squidmanheis on July 08, 2017, 01:17:00 am
Facesitting Bitches - The Office Geek

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/l/4cQlM/Facesitting%20Bitches%20-%20The%20Office%20Geek_cover.jpg) (http://pimpandhost.com/image/62166518)


File Name : Facesitting Bitches - The Office Geek
Runtime : 30min 44s
File Size : 172 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/l/4cQlN/Facesitting%20Bitches%20-%20The%20Office%20Geek_thumb_0.jpg) (http://pimpandhost.com/image/62166519)

Download Links:

Facesitting Bitches - The Office Geek.rar (http://k2s.cc/file/25e30d0fb3e78)
Title: Facesitting Bitches The Worm Has Turned
Post by: squidmanheis on July 08, 2017, 04:16:57 am
Facesitting Bitches - The Worm Has Turned

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/s/4gEs1/Facesitting%20Bitches%20-%20The%20Worm%20Has%20Turned_cover.jpg) (http://pimpandhost.com/image/63074089)


File Name : Facesitting Bitches - The Worm Has Turned
Runtime : 31min 29s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/s/4gEs3/Facesitting%20Bitches%20-%20The%20Worm%20Has%20Turned_thumb_0.jpg) (http://pimpandhost.com/image/63074091)

Download Links:

Facesitting Bitches - The Worm Has Turned.rar (http://k2s.cc/file/200fd1152551f)
Title: Facesitting Bitches Trapped
Post by: squidmanheis on July 08, 2017, 07:16:58 am
Facesitting Bitches - Trapped

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/u/4gEuv/Facesitting%20Bitches%20-%20Trapped_cover.jpg) (http://pimpandhost.com/image/63074243)


File Name : Facesitting Bitches - Trapped
Runtime : 32min 34s
File Size : 182 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/u/4gEuw/Facesitting%20Bitches%20-%20Trapped_thumb_0.jpg) (http://pimpandhost.com/image/63074244)

Download Links:

Facesitting Bitches - Trapped.rar (http://k2s.cc/file/3b506b3aa6c01)
Title: Facesitting Bitches Trouble Breathing
Post by: squidmanheis on July 08, 2017, 10:16:44 am
Facesitting Bitches - Trouble Breathing

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/v/4gEvi/Facesitting%20Bitches%20-%20Trouble%20Breathing_cover.jpg) (http://pimpandhost.com/image/63074292)


File Name : Facesitting Bitches - Trouble Breathing
Runtime : 31min 21s
File Size : 176 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/v/4gEvk/Facesitting%20Bitches%20-%20Trouble%20Breathing_thumb_0.jpg) (http://pimpandhost.com/image/63074294)

Download Links:

Facesitting Bitches - Trouble Breathing.rar (http://k2s.cc/file/f5edb66a526b0)
Title: Facesitting Bitches You Were Looking
Post by: squidmanheis on July 08, 2017, 01:16:54 pm
Facesitting Bitches - You Were Looking

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/v/4cQvh/Facesitting%20Bitches%20-%20You%20Were%20Looking_cover.jpg) (http://pimpandhost.com/image/62167107)


File Name : Facesitting Bitches - You Were Looking
Runtime : 30min 35s
File Size : 171 MB
File Type: wmv
Resolution : 720x576

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/v/4cQvi/Facesitting%20Bitches%20-%20You%20Were%20Looking_thumb_0.jpg) (http://pimpandhost.com/image/62167108)

Download Links:

Facesitting Bitches - You Were Looking.rar (http://k2s.cc/file/8cd9636cb3643)
Title: Facesitting sveta brusser ksusha galushko
Post by: squidmanheis on July 08, 2017, 04:16:54 pm
Facesitting sveta brusser ksusha galushko

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/v/4cQvQ/Facesitting%20sveta%20brusser%20ksusha%20galushko_cover.jpg) (http://pimpandhost.com/image/62167142)


File Name : Facesitting sveta brusser ksusha galushko
Runtime : 18min 10s
File Size : 139 MB
File Type: wmv
Resolution : 640x480

(http://ist3-4.filesor.com/pimpandhost.com/1/2/4/5/124593/4/c/Q/v/4cQvS/Facesitting%20sveta%20brusser%20ksusha%20galushko_thumb_0.jpg) (http://pimpandhost.com/image/62167144)

Download Links:

Facesitting sveta brusser ksusha galushko.rar (http://k2s.cc/file/d78291b9a3e56)
Title: Facesitting videos cl 1475
Post by: squidmanheis on July 08, 2017, 07:16:51 pm
Facesitting videos cl 1475

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/I/4gEIF/Facesitting%20videos%20cl%201475_cover.jpg) (http://pimpandhost.com/image/63075121)


File Name : Facesitting videos cl 1475
Runtime : 6min 21s
File Size : 79.1 MB
File Type: wmv
Resolution : 1024x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/I/4gEIN/Facesitting%20videos%20cl%201475_thumb_0.jpg) (http://pimpandhost.com/image/63075129)

Download Links:

Facesitting videos cl 1475.rar (http://k2s.cc/file/a9a9dd38f1f84)
Title: Facesitting videos cl 185
Post by: squidmanheis on July 08, 2017, 10:17:15 pm
Facesitting videos cl 185



File Name : Facesitting videos cl 185
Runtime : 5min 40s
File Size : 65.2 MB
File Type: wmv
Resolution : 1024x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/L/4gELr/Facesitting%20videos%20cl%20185_thumb_0.jpg) (http://pimpandhost.com/image/63075293)

Download Links:

Facesitting videos cl 185.rar (http://k2s.cc/file/b1c191641c629)
Title: Facesitting videos hot girl fs fs victim
Post by: squidmanheis on July 09, 2017, 04:17:14 am
Facesitting videos hot girl fs fs victim

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/2/4gF2s/Facesitting%20videos%20hot%20girl%20fs%20fs%20victim_cover.jpg) (http://pimpandhost.com/image/63076348)


File Name : Facesitting videos hot girl fs fs victim
Runtime : 11min 51s
File Size : 67.6 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/2/4gF2z/Facesitting%20videos%20hot%20girl%20fs%20fs%20victim_thumb_0.jpg) (http://pimpandhost.com/image/63076355)

Download Links:

Facesitting videos hot girl fs fs victim.rar (http://k2s.cc/file/748d75f64e00f)
Title: Facesitting videos Licking Eris after she was on toilet Femdom Vip
Post by: squidmanheis on July 09, 2017, 07:17:11 am
Facesitting videos Licking Eris after she was on toilet - Femdom Vip

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/7/4gF72/Facesitting%20videos%20Licking%20Eris%20after%20she%20was%20on%20toilet%20-%20Femdom%20Vip_cover.jpg) (http://pimpandhost.com/image/63076632)


File Name : Facesitting videos Licking Eris after she was on toilet - Femdom Vip
Runtime : 4min 53s
File Size : 19.7 MB
File Type: mp4
Resolution : 852x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/7/4gF78/Facesitting%20videos%20Licking%20Eris%20after%20she%20was%20on%20toilet%20-%20Femdom%20Vip_thumb_0.jpg) (http://pimpandhost.com/image/63076638)

Download Links:

Facesitting videos Licking Eris after she was on toilet - Femdom Vip.rar (http://k2s.cc/file/91bdb734ed0ee)
Title: Facesitting videos Face fucked with her hairy pussy
Post by: squidmanheis on July 09, 2017, 08:22:21 am
Facesitting videos Face fucked with her hairy pussy

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/Z/4gEZ3/Facesitting%20videos%20Face%20fucked%20with%20her%20hairy%20pussy_cover.jpg) (http://pimpandhost.com/image/63076137)


File Name : Facesitting videos Face fucked with her hairy pussy
Runtime : 6min 14s
File Size : 76.2 MB
File Type: mp4
Resolution : 1280x720

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/E/Z/4gEZ6/Facesitting%20videos%20Face%20fucked%20with%20her%20hairy%20pussy_thumb_0.jpg) (http://pimpandhost.com/image/63076140)

Download Links:

Facesitting videos Face fucked with her hairy pussy.rar (http://k2s.cc/file/dcd87ba59af03)
Title: Facesitting videos Ms Clara and her old dog
Post by: squidmanheis on July 09, 2017, 10:17:09 am
Facesitting videos Ms Clara and her old dog

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/a/4gFas/Facesitting%20videos%20Ms%20Clara%20and%20her%20old%20dog_cover.jpg) (http://pimpandhost.com/image/63076844)


File Name : Facesitting videos Ms Clara and her old dog
Runtime : 11min 2s
File Size : 75.6 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/a/4gFav/Facesitting%20videos%20Ms%20Clara%20and%20her%20old%20dog_thumb_0.jpg) (http://pimpandhost.com/image/63076847)

Download Links:

Facesitting videos Ms Clara and her old dog.rar (http://k2s.cc/file/68dc26d23f9e4)
Title: Facesitting videos Sorry your hurt but you still have to clean my ass
Post by: squidmanheis on July 09, 2017, 01:17:09 pm
Facesitting videos Sorry your hurt but you still have to clean my ass

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/f/4gFfc/Facesitting%20videos%20Sorry%20your%20hurt%20but%20you%20still%20have%20to%20clean%20my%20ass_cover.jpg) (http://pimpandhost.com/image/63077138)


File Name : Facesitting videos Sorry your hurt but you still have to clean my ass
Runtime : 11min 3s
File Size : 118 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/f/4gFfi/Facesitting%20videos%20Sorry%20your%20hurt%20but%20you%20still%20have%20to%20clean%20my%20ass_thumb_0.jpg) (http://pimpandhost.com/image/63077144)

Download Links:

Facesitting videos Sorry your hurt but you still have to clean my ass.rar (http://k2s.cc/file/b8428813b4fa4)
Title: Hottestfacesitting 01 Mistress Nastya
Post by: squidmanheis on July 09, 2017, 04:17:08 pm
Hottestfacesitting 01 Mistress Nastya

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/j/4gFjh/Hottestfacesitting%2001%20Mistress%20Nastya%20_cover.jpg) (http://pimpandhost.com/image/63077391)


File Name : Hottestfacesitting 01 Mistress Nastya
Runtime : 11min 46s
File Size : 113 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/j/4gFjn/Hottestfacesitting%2001%20Mistress%20Nastya%20_thumb_0.jpg) (http://pimpandhost.com/image/63077397)

Download Links:

Hottestfacesitting 01 Mistress Nastya .rar (http://k2s.cc/file/00f19c9471827)
Title: Hottestfacesitting 011 Mistress Olga
Post by: squidmanheis on July 09, 2017, 07:17:06 pm
Hottestfacesitting 011 Mistress Olga

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/o/4gFo5/Hottestfacesitting%20011%20Mistress%20Olga%20_cover.jpg) (http://pimpandhost.com/image/63077689)


File Name : Hottestfacesitting 011 Mistress Olga
Runtime : 18min 31s
File Size : 173 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/o/4gFob/Hottestfacesitting%20011%20Mistress%20Olga%20_thumb_0.jpg) (http://pimpandhost.com/image/63077695)

Download Links:

Hottestfacesitting 011 Mistress Olga .rar (http://k2s.cc/file/b8708973377f4)
Title: Hottestfacesitting 017 Mistresses Alesya and Annya
Post by: squidmanheis on July 09, 2017, 10:17:24 pm
Hottestfacesitting 017 Mistresses Alesya and Annya

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/X/4gFXx/Hottestfacesitting%20017%20Mistresses%20Alesya%20and%20Annya%20_cover.jpg) (http://pimpandhost.com/image/63079887)


File Name : Hottestfacesitting 017 Mistresses Alesya and Annya
Runtime : 18min 15s
File Size : 275 MB
File Type: wmv
Resolution : 720x576

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/F/X/4gFXD/Hottestfacesitting%20017%20Mistresses%20Alesya%20and%20Annya%20_thumb_0.jpg) (http://pimpandhost.com/image/63079893)

Download Links:

Hottestfacesitting 017 Mistresses Alesya and Annya .rar (http://k2s.cc/file/63b52ddb9d39a)
Title: Hottestfacesitting 04 Mistress Julia Mistress Lera
Post by: squidmanheis on July 10, 2017, 01:17:09 am
Hottestfacesitting 04 Mistress Julia  Mistress Lera

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/k/4gJkt/Hottestfacesitting%2004%20Mistress%20Julia%20%20Mistress%20Lera%20_cover.jpg) (http://pimpandhost.com/image/63092841)


File Name : Hottestfacesitting 04 Mistress Julia  Mistress Lera
Runtime : 11min 33s
File Size : 111 MB
File Type: wmv
Resolution : 640x480

(http://ist3-5.filesor.com/pimpandhost.com/1/2/4/5/124593/4/g/J/l/4gJlT/Hottestfacesitting%2004%20Mistress%20Julia%20%20Mistress%20Lera%20_thumb_0.jpg) (http://pimpandhost.com/image/63092929)

Download Links:

Hottestfacesitting 04 Mistress Julia  Mistress Lera .rar (http://k2s.cc/file/26dcfedf48fca)
Title: Facesitting abeutiful butt
Post by: squidmanheis on August 18, 2017, 02:11:10 am
Facesitting abeutiful butt

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/a/4vbas/Facesitting%20abeutiful%20butt_cover.jpg) (http://pimpandhost.com/image/66536444)


File Name : Facesitting abeutiful butt
Runtime : 19min 13s
File Size : 91.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/a/4vbat/Facesitting%20abeutiful%20butt_thumb_0.jpg) (http://pimpandhost.com/image/66536445)

Download Links:

Facesitting abeutiful butt.rar (http://k2s.cc/file/8c92b8a764f65)
Title: Facesitting abusing theslaveface
Post by: squidmanheis on August 18, 2017, 04:51:08 am
Facesitting abusing theslaveface

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/b/4vbba/Facesitting%20abusing%20theslaveface_cover.jpg) (http://pimpandhost.com/image/66536488)


File Name : Facesitting abusing theslaveface
Runtime : 19min 13s
File Size : 91.6 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/b/4vbbd/Facesitting%20abusing%20theslaveface_thumb_0.jpg) (http://pimpandhost.com/image/66536491)

Download Links:

Facesitting abusing theslaveface.rar (http://k2s.cc/file/8194b33775132)
Title: Facesitting adriellys return
Post by: squidmanheis on August 18, 2017, 07:31:09 am
Facesitting adriellys return

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/c/4vbcm/Facesitting%20adriellys%20return_cover.jpg) (http://pimpandhost.com/image/66536562)


File Name : Facesitting adriellys return
Runtime : 20min 25s
File Size : 92.5 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/c/4vbco/Facesitting%20adriellys%20return_thumb_0.jpg) (http://pimpandhost.com/image/66536564)

Download Links:

Facesitting adriellys return.rar (http://k2s.cc/file/3a752ff890faf)
Title: Facesitting african facesitting
Post by: squidmanheis on August 18, 2017, 10:11:28 am
Facesitting african facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/d/4vbdw/Facesitting%20african%20facesitting_cover.jpg) (http://pimpandhost.com/image/66536634)


File Name : Facesitting african facesitting
Runtime : 19min 13s
File Size : 91.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/d/4vbdz/Facesitting%20african%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66536637)

Download Links:

Facesitting african facesitting.rar (http://k2s.cc/file/ac7aadb3e15a7)
Title: Facesitting african facesitting
Post by: squidmanheis on August 18, 2017, 10:12:05 am
Facesitting african facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/d/4vbdw/Facesitting%20african%20facesitting_cover.jpg) (http://pimpandhost.com/image/66536634)


File Name : Facesitting african facesitting
Runtime : 19min 13s
File Size : 91.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/d/4vbdz/Facesitting%20african%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66536637)

Download Links:

Facesitting african facesitting.rar (http://k2s.cc/file/ac7aadb3e15a7)
Title: Facesitting agressive ass
Post by: squidmanheis on August 18, 2017, 12:51:04 pm
Facesitting agressive ass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/e/4vbeW/Facesitting%20agressive%20ass_cover.jpg) (http://pimpandhost.com/image/66536722)


File Name : Facesitting agressive ass
Runtime : 18min 49s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/f/4vbf0/Facesitting%20agressive%20ass_thumb_0.jpg) (http://pimpandhost.com/image/66536726)

Download Links:

Facesitting agressive ass.rar (http://k2s.cc/file/6eaf59facc44f)
Title: Facesitting agressivereturn offlavia
Post by: squidmanheis on August 18, 2017, 03:31:04 pm
Facesitting agressivereturn offlavia

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/h/4vbhx/Facesitting%20agressivereturn%20offlavia_cover.jpg) (http://pimpandhost.com/image/66536883)


File Name : Facesitting agressivereturn offlavia
Runtime : 19min 25s
File Size : 197 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/h/4vbhI/Facesitting%20agressivereturn%20offlavia_thumb_0.jpg) (http://pimpandhost.com/image/66536894)

Download Links:

Facesitting agressivereturn offlavia.rar (http://k2s.cc/file/4278cf7d69014)
Title: Facesitting alessandras firstface
Post by: squidmanheis on August 18, 2017, 06:11:15 pm
Facesitting alessandras firstface

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/m/4vbmE/Facesitting%20alessandras%20firstface_cover.jpg) (http://pimpandhost.com/image/66537200)


File Name : Facesitting alessandras firstface
Runtime : 19min 13s
File Size : 201 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/m/4vbmQ/Facesitting%20alessandras%20firstface_thumb_0.jpg) (http://pimpandhost.com/image/66537212)

Download Links:

Facesitting alessandras firstface.rar (http://k2s.cc/file/996f856e9f9bb)
Title: Facesitting always lose
Post by: squidmanheis on August 18, 2017, 08:51:01 pm
Facesitting always lose

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/u/4vbuJ/Facesitting%20always%20lose_cover.jpg) (http://pimpandhost.com/image/66537701)


File Name : Facesitting always lose
Runtime : 15min 35s
File Size : 161 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/u/4vbuX/Facesitting%20always%20lose_thumb_0.jpg) (http://pimpandhost.com/image/66537715)

Download Links:

Facesitting always lose.rar (http://k2s.cc/file/1728932540189)
Title: Facesitting angelas firstface
Post by: squidmanheis on August 18, 2017, 11:30:55 pm
Facesitting angelas firstface

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/B/4vbBd/Facesitting%20angelas%20firstface_cover.jpg) (http://pimpandhost.com/image/66538103)


File Name : Facesitting angelas firstface
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/B/4vbBo/Facesitting%20angelas%20firstface_thumb_0.jpg) (http://pimpandhost.com/image/66538114)

Download Links:

Facesitting angelas firstface.rar (http://k2s.cc/file/ae43f086b9400)
Title: Facesitting annies revenge
Post by: squidmanheis on August 19, 2017, 02:10:58 am
Facesitting annies revenge

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/E/4vbEI/Facesitting%20annies%20revenge_cover.jpg) (http://pimpandhost.com/image/66538320)


File Name : Facesitting annies revenge
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/E/4vbEM/Facesitting%20annies%20revenge_thumb_0.jpg) (http://pimpandhost.com/image/66538324)

Download Links:

Facesitting annies revenge.rar (http://k2s.cc/file/00fbe1abaf67c)
Title: Facesitting appetite forfacesitting
Post by: squidmanheis on August 21, 2017, 07:30:51 pm
Facesitting appetite forfacesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/J/4vbJ8/Facesitting%20appetite%20forfacesitting_cover.jpg) (http://pimpandhost.com/image/66538594)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting appetite forfacesitting
Runtime : 19min 13s
File Size : 91.7 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/J/4vbJb/Facesitting%20appetite%20forfacesitting_thumb_0.jpg) (http://pimpandhost.com/image/66538597)

Download Links:

Facesitting appetite forfacesitting.rar (http://k2s.cc/file/f7ee33de0b5e9)
Title: Facesitting artof smothering
Post by: squidmanheis on August 21, 2017, 10:30:53 pm
Facesitting artof smothering

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/K/4vbKy/Facesitting%20artof%20smothering_cover.jpg) (http://pimpandhost.com/image/66538682)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting artof smothering
Runtime : 19min 37s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/K/4vbKD/Facesitting%20artof%20smothering_thumb_0.jpg) (http://pimpandhost.com/image/66538687)

Download Links:

Facesitting artof smothering.rar (http://k2s.cc/file/774eda222f9ac)
Title: Facesitting ass action
Post by: squidmanheis on August 22, 2017, 01:30:52 am
Facesitting ass action

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/O/4vbOu/Facesitting%20ass%20action_cover.jpg) (http://pimpandhost.com/image/66538926)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting ass action
Runtime : 19min 1s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/O/4vbOA/Facesitting%20ass%20action_thumb_0.jpg) (http://pimpandhost.com/image/66538932)

Download Links:

Facesitting ass action.rar (http://k2s.cc/file/274093b69fbef)
Title: Facesitting asses attack
Post by: squidmanheis on August 22, 2017, 04:31:00 am
Facesitting asses attack

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/R/4vbRC/Facesitting%20asses%20attack_cover.jpg) (http://pimpandhost.com/image/66539120)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting asses attack
Runtime : 19min 1s
File Size : 199 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/R/4vbRF/Facesitting%20asses%20attack_thumb_0.jpg) (http://pimpandhost.com/image/66539123)

Download Links:

Facesitting asses attack.rar (http://k2s.cc/file/e35761bc3c731)
Title: Facesitting ayumes return
Post by: squidmanheis on August 22, 2017, 07:31:32 am
Facesitting ayumes return

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/W/4vbWj/Facesitting%20ayumes%20return_cover.jpg) (http://pimpandhost.com/image/66539411)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting ayumes return
Runtime : 19min 13s
File Size : 91.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/W/4vbWn/Facesitting%20ayumes%20return_thumb_0.jpg) (http://pimpandhost.com/image/66539415)

Download Links:

Facesitting ayumes return.rar (http://k2s.cc/file/ec829cf180288)
Title: Facesitting ayumes return
Post by: squidmanheis on August 22, 2017, 07:31:49 am
Facesitting ayumes return

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/W/4vbWj/Facesitting%20ayumes%20return_cover.jpg) (http://pimpandhost.com/image/66539411)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting ayumes return
Runtime : 19min 13s
File Size : 91.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/W/4vbWn/Facesitting%20ayumes%20return_thumb_0.jpg) (http://pimpandhost.com/image/66539415)

Download Links:

Facesitting ayumes return.rar (http://k2s.cc/file/ec829cf180288)
Title: Facesitting bad ass
Post by: squidmanheis on August 22, 2017, 10:30:48 am
Facesitting bad ass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/Y/4vbYR/Facesitting%20bad%20ass_cover.jpg) (http://pimpandhost.com/image/66539569)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting bad ass
Runtime : 19min 13s
File Size : 201 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/b/Y/4vbYX/Facesitting%20bad%20ass_thumb_0.jpg) (http://pimpandhost.com/image/66539575)

Download Links:

Facesitting bad ass.rar (http://k2s.cc/file/d4ef43abffdd2)
Title: Facesitting be quiet
Post by: squidmanheis on August 22, 2017, 01:30:44 pm
Facesitting be quiet

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/2/4vc2h/Facesitting%20be%20quiet_cover.jpg) (http://pimpandhost.com/image/66539781)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting be quiet
Runtime : 19min 13s
File Size : 92.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/2/4vc2j/Facesitting%20be%20quiet_thumb_0.jpg) (http://pimpandhost.com/image/66539783)

Download Links:

Facesitting be quiet.rar (http://k2s.cc/file/431f51be48c14)
Title: Facesitting beatrizfirst facesitting
Post by: squidmanheis on August 22, 2017, 04:30:46 pm
Facesitting beatrizfirst facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/4/4vc4c/Facesitting%20beatrizfirst%20facesitting_cover.jpg) (http://pimpandhost.com/image/66539900)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting beatrizfirst facesitting
Runtime : 18min 49s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/4/4vc4k/Facesitting%20beatrizfirst%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66539908)

Download Links:

Facesitting beatrizfirst facesitting.rar (http://k2s.cc/file/92fe891e35d05)
Title: Facesitting beautiful cruel
Post by: squidmanheis on August 22, 2017, 07:30:43 pm
Facesitting beautiful cruel

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/8/4vc8M/Facesitting%20beautiful%20cruel_cover.jpg) (http://pimpandhost.com/image/66540184)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting beautiful cruel
Runtime : 19min 25s
File Size : 197 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/8/4vc8S/Facesitting%20beautiful%20cruel_thumb_0.jpg) (http://pimpandhost.com/image/66540190)

Download Links:

Facesitting beautiful cruel.rar (http://k2s.cc/file/82e8ca5760a1f)
Title: Facesitting beautifuland cruel
Post by: squidmanheis on August 22, 2017, 10:30:59 pm
Facesitting beautifuland cruel

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/c/4vccy/Facesitting%20beautifuland%20cruel_cover.jpg) (http://pimpandhost.com/image/66540418)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting beautifuland cruel
Runtime : 19min 1s
File Size : 198 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/c/4vccH/Facesitting%20beautifuland%20cruel_thumb_0.jpg) (http://pimpandhost.com/image/66540427)

Download Links:

Facesitting beautifuland cruel.rar (http://k2s.cc/file/821347ca615d5)
Title: Facesitting beautifulblackass inhernose
Post by: squidmanheis on August 23, 2017, 01:30:58 am
Facesitting beautifulblackass inhernose

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/g/4vcgo/Facesitting%20beautifulblackass%20inhernose_cover.jpg) (http://pimpandhost.com/image/66540656)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting beautifulblackass inhernose
Runtime : 19min 13s
File Size : 91.7 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/g/4vcgu/Facesitting%20beautifulblackass%20inhernose_thumb_0.jpg) (http://pimpandhost.com/image/66540662)

Download Links:

Facesitting beautifulblackass inhernose.rar (http://k2s.cc/file/50c5de7c86786)
Title: Facesitting bigblackbutt onyourface
Post by: squidmanheis on August 23, 2017, 04:30:56 am
Facesitting bigblackbutt onyourface

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/h/4vchR/Facesitting%20bigblackbutt%20onyourface_cover.jpg) (http://pimpandhost.com/image/66540747)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting bigblackbutt onyourface
Runtime : 19min 1s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/h/4vchU/Facesitting%20bigblackbutt%20onyourface_thumb_0.jpg) (http://pimpandhost.com/image/66540750)

Download Links:

Facesitting bigblackbutt onyourface.rar (http://k2s.cc/file/8e3bd6277d2b2)
Title: Facesitting bigbuttinyourface
Post by: squidmanheis on August 23, 2017, 07:30:53 am
Facesitting bigbuttinyourface

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/l/4vcl2/Facesitting%20bigbuttinyourface_cover.jpg) (http://pimpandhost.com/image/66540944)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting bigbuttinyourface
Runtime : 19min 27s
File Size : 91.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/l/4vcl4/Facesitting%20bigbuttinyourface_thumb_0.jpg) (http://pimpandhost.com/image/66540946)

Download Links:

Facesitting bigbuttinyourface.rar (http://k2s.cc/file/8accaf4ad92ad)
Title: Facesitting brendaisback
Post by: squidmanheis on August 23, 2017, 10:30:54 am
Facesitting brendaisback

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/n/4vcnE/Facesitting%20brendaisback_cover.jpg) (http://pimpandhost.com/image/66541106)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting brendaisback
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/n/4vcnH/Facesitting%20brendaisback_thumb_0.jpg) (http://pimpandhost.com/image/66541109)

Download Links:

Facesitting brendaisback.rar (http://k2s.cc/file/2156cab55fc7b)
Title: Facesitting brunas firstface
Post by: squidmanheis on August 23, 2017, 01:30:51 pm
Facesitting brunas firstface

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/p/4vcpC/Facesitting%20brunas%20firstface_cover.jpg) (http://pimpandhost.com/image/66541228)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting brunas firstface
Runtime : 19min 13s
File Size : 203 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/p/4vcpG/Facesitting%20brunas%20firstface_thumb_0.jpg) (http://pimpandhost.com/image/66541232)

Download Links:

Facesitting brunas firstface.rar (http://k2s.cc/file/649ed5110a65d)
Title: Facesitting brutal facesitting
Post by: squidmanheis on August 23, 2017, 04:30:48 pm
Facesitting brutal facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/s/4vcsE/Facesitting%20brutal%20facesitting_cover.jpg) (http://pimpandhost.com/image/66541416)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting brutal facesitting
Runtime : 19min 13s
File Size : 91.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/s/4vcsJ/Facesitting%20brutal%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66541421)

Download Links:

Facesitting brutal facesitting.rar (http://k2s.cc/file/16c4c71dcc75e)
Title: Facesitting butt inface
Post by: squidmanheis on August 23, 2017, 07:30:45 pm
Facesitting butt inface

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/u/4vcu2/Facesitting%20butt%20inface_cover.jpg) (http://pimpandhost.com/image/66541502)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting butt inface
Runtime : 19min 9s
File Size : 91.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/u/4vcu8/Facesitting%20butt%20inface_thumb_0.jpg) (http://pimpandhost.com/image/66541508)

Download Links:

Facesitting butt inface.rar (http://k2s.cc/file/3cbde5929961d)
Title: Facesitting control mistress
Post by: squidmanheis on August 23, 2017, 10:30:45 pm
Facesitting control mistress

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/v/4vcv8/Facesitting%20control%20mistress_cover.jpg) (http://pimpandhost.com/image/66541570)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting control mistress
Runtime : 19min 17s
File Size : 92.0 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/v/4vcvb/Facesitting%20control%20mistress_thumb_0.jpg) (http://pimpandhost.com/image/66541573)

Download Links:

Facesitting control mistress.rar (http://k2s.cc/file/ef42c6eea67e9)
Title: Facesitting crazy bitch
Post by: squidmanheis on August 24, 2017, 01:30:43 am
Facesitting crazy bitch

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/x/4vcxq/Facesitting%20crazy%20bitch_cover.jpg) (http://pimpandhost.com/image/66541712)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting crazy bitch
Runtime : 19min 13s
File Size : 91.6 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/x/4vcxt/Facesitting%20crazy%20bitch_thumb_0.jpg) (http://pimpandhost.com/image/66541715)

Download Links:

Facesitting crazy bitch.rar (http://k2s.cc/file/61b7761e24f1e)
Title: Facesitting crazy blackass
Post by: squidmanheis on August 24, 2017, 04:30:45 am
Facesitting crazy blackass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/y/4vcyB/Facesitting%20crazy%20blackass_cover.jpg) (http://pimpandhost.com/image/66541785)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting crazy blackass
Runtime : 19min 1s
File Size : 198 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/y/4vcyE/Facesitting%20crazy%20blackass_thumb_0.jpg) (http://pimpandhost.com/image/66541788)

Download Links:

Facesitting crazy blackass.rar (http://k2s.cc/file/f831b2b4ea211)
Title: Facesitting cream face choco
Post by: squidmanheis on August 24, 2017, 07:30:43 am
Facesitting cream face choco

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/A/4vcAV/Facesitting%20cream%20face%20choco_cover.jpg) (http://pimpandhost.com/image/66541929)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting cream face choco
Runtime : 19min 13s
File Size : 91.7 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/A/4vcAX/Facesitting%20cream%20face%20choco_thumb_0.jpg) (http://pimpandhost.com/image/66541931)

Download Links:

Facesitting cream face choco.rar (http://k2s.cc/file/e6440b271d0b1)
Title: Facesitting cruel facesitting
Post by: squidmanheis on August 24, 2017, 10:30:40 am
Facesitting cruel facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/D/4vcDu/Facesitting%20cruel%20facesitting_cover.jpg) (http://pimpandhost.com/image/66542088)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting cruel facesitting
Runtime : 12min 59s
File Size : 60.9 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/D/4vcDv/Facesitting%20cruel%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66542089)

Download Links:

Facesitting cruel facesitting.rar (http://k2s.cc/file/e0b3c7908c2df)
Title: Facesitting cumon myface
Post by: squidmanheis on August 24, 2017, 01:30:40 pm
Facesitting cumon myface

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/D/4vcDP/Facesitting%20cumon%20myface_cover.jpg) (http://pimpandhost.com/image/66542109)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting cumon myface
Runtime : 19min 13s
File Size : 91.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/D/4vcDQ/Facesitting%20cumon%20myface_thumb_0.jpg) (http://pimpandhost.com/image/66542110)

Download Links:

Facesitting cumon myface.rar (http://k2s.cc/file/a181c24c7929f)
Title: Facesitting dancing theface
Post by: squidmanheis on August 24, 2017, 04:30:36 pm
Facesitting dancing theface

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/E/4vcE9/Facesitting%20dancing%20theface_cover.jpg) (http://pimpandhost.com/image/66542129)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting dancing theface
Runtime : 19min 13s
File Size : 91.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/E/4vcEh/Facesitting%20dancing%20theface_thumb_0.jpg) (http://pimpandhost.com/image/66542137)

Download Links:

Facesitting dancing theface.rar (http://k2s.cc/file/fd0d4a6d644c0)
Title: Facesitting disciplinary action
Post by: squidmanheis on August 24, 2017, 07:30:35 pm
Facesitting disciplinary action

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/F/4vcFd/Facesitting%20disciplinary%20action_cover.jpg) (http://pimpandhost.com/image/66542195)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting disciplinary action
Runtime : 19min 12s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/F/4vcFh/Facesitting%20disciplinary%20action_thumb_0.jpg) (http://pimpandhost.com/image/66542199)

Download Links:

Facesitting disciplinary action.rar (http://k2s.cc/file/0461edc396185)
Title: Facesitting dont touchme
Post by: squidmanheis on August 24, 2017, 10:30:59 pm
Facesitting dont touchme

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/H/4vcHF/Facesitting%20dont%20touchme_cover.jpg) (http://pimpandhost.com/image/66542347)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting dont touchme
Runtime : 19min 26s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/H/4vcHK/Facesitting%20dont%20touchme_thumb_0.jpg) (http://pimpandhost.com/image/66542352)

Download Links:

Facesitting dont touchme.rar (http://k2s.cc/file/bcc6166d0f9f4)
Title: Facesitting dont touchme
Post by: squidmanheis on August 24, 2017, 10:31:34 pm
Facesitting dont touchme

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/H/4vcHF/Facesitting%20dont%20touchme_cover.jpg) (http://pimpandhost.com/image/66542347)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting dont touchme
Runtime : 19min 26s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/H/4vcHK/Facesitting%20dont%20touchme_thumb_0.jpg) (http://pimpandhost.com/image/66542352)

Download Links:

Facesitting dont touchme.rar (http://k2s.cc/file/bcc6166d0f9f4)
Title: Facesitting dontcrycarol
Post by: squidmanheis on August 25, 2017, 01:30:33 am
Facesitting dontcrycarol

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/K/4vcK4/Facesitting%20dontcrycarol_cover.jpg) (http://pimpandhost.com/image/66542496)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting dontcrycarol
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/K/4vcKc/Facesitting%20dontcrycarol_thumb_0.jpg) (http://pimpandhost.com/image/66542504)

Download Links:

Facesitting dontcrycarol.rar (http://k2s.cc/file/f12c86a5483c6)
Title: Facesitting dontlie bitch
Post by: squidmanheis on August 25, 2017, 04:30:31 am
Facesitting dontlie bitch

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/M/4vcMF/Facesitting%20dontlie%20bitch_cover.jpg) (http://pimpandhost.com/image/66542657)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting dontlie bitch
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/M/4vcMM/Facesitting%20dontlie%20bitch_thumb_0.jpg) (http://pimpandhost.com/image/66542664)

Download Links:

Facesitting dontlie bitch.rar (http://k2s.cc/file/493be932a0d9d)
Title: Facesitting double face
Post by: squidmanheis on August 25, 2017, 07:30:29 am
Facesitting double face

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/P/4vcPN/Facesitting%20double%20face_cover.jpg) (http://pimpandhost.com/image/66542851)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting double face
Runtime : 19min 12s
File Size : 91.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/P/4vcPR/Facesitting%20double%20face_thumb_0.jpg) (http://pimpandhost.com/image/66542855)

Download Links:

Facesitting double face.rar (http://k2s.cc/file/307dc534a1deb)
Title: Facesitting doubleface michael
Post by: squidmanheis on August 25, 2017, 10:30:27 am
Facesitting doubleface michael

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/R/4vcR0/Facesitting%20doubleface%20michael_cover.jpg) (http://pimpandhost.com/image/66542926)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting doubleface michael
Runtime : 19min 12s
File Size : 91.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/R/4vcR2/Facesitting%20doubleface%20michael_thumb_0.jpg) (http://pimpandhost.com/image/66542928)

Download Links:

Facesitting doubleface michael.rar (http://k2s.cc/file/557eaf940d292)
Title: Facesitting doubletrouble formichael
Post by: squidmanheis on August 25, 2017, 01:30:25 pm
Facesitting doubletrouble formichael

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/S/4vcSr/Facesitting%20doubletrouble%20formichael_cover.jpg) (http://pimpandhost.com/image/66543015)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting doubletrouble formichael
Runtime : 19min 13s
File Size : 91.6 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/S/4vcSu/Facesitting%20doubletrouble%20formichael_thumb_0.jpg) (http://pimpandhost.com/image/66543018)

Download Links:

Facesitting doubletrouble formichael.rar (http://k2s.cc/file/13ec7d00159a1)
Title: Facesitting escapemenever
Post by: squidmanheis on August 25, 2017, 04:30:27 pm
Facesitting escapemenever

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/S/4vcSG/Facesitting%20escapemenever_cover.jpg) (http://pimpandhost.com/image/66543030)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting escapemenever
Runtime : 19min 18s
File Size : 91.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/S/4vcSH/Facesitting%20escapemenever_thumb_0.jpg) (http://pimpandhost.com/image/66543031)

Download Links:

Facesitting escapemenever.rar (http://k2s.cc/file/0e97a042b9085)
Title: Facesitting fabianas facesitting
Post by: squidmanheis on August 25, 2017, 07:30:24 pm
Facesitting fabianas facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/T/4vcTl/Facesitting%20fabianas%20facesitting_cover.jpg) (http://pimpandhost.com/image/66543071)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fabianas facesitting
Runtime : 19min 1s
File Size : 199 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/T/4vcTo/Facesitting%20fabianas%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66543074)

Download Links:

Facesitting fabianas facesitting.rar (http://k2s.cc/file/d9531c1e0e7a8)
Title: Facesitting face bikini
Post by: squidmanheis on August 25, 2017, 10:30:22 pm
Facesitting face bikini

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/U/4vcUh/Facesitting%20face%20bikini_cover.jpg) (http://pimpandhost.com/image/66543129)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting face bikini
Runtime : 19min 13s
File Size : 91.9 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/U/4vcUi/Facesitting%20face%20bikini_thumb_0.jpg) (http://pimpandhost.com/image/66543130)

Download Links:

Facesitting face bikini.rar (http://k2s.cc/file/cfab5cb9ecfc0)
Title: Facesitting face blackwhite
Post by: squidmanheis on August 26, 2017, 01:30:21 am
Facesitting face blackwhite

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/U/4vcUT/Facesitting%20face%20blackwhite_cover.jpg) (http://pimpandhost.com/image/66543167)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting face blackwhite
Runtime : 19min 12s
File Size : 91.2 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/U/4vcUV/Facesitting%20face%20blackwhite_thumb_0.jpg) (http://pimpandhost.com/image/66543169)

Download Links:

Facesitting face blackwhite.rar (http://k2s.cc/file/6ab1869c3de94)
Title: Facesitting face interracial
Post by: squidmanheis on August 26, 2017, 04:30:20 am
Facesitting face interracial

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/V/4vcVq/Facesitting%20face%20interracial_cover.jpg) (http://pimpandhost.com/image/66543200)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting face interracial
Runtime : 19min 12s
File Size : 91.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/V/4vcVv/Facesitting%20face%20interracial_thumb_0.jpg) (http://pimpandhost.com/image/66543205)

Download Links:

Facesitting face interracial.rar (http://k2s.cc/file/f6675acfa186d)
Title: Facesitting face intheclub
Post by: squidmanheis on August 26, 2017, 07:30:18 am
Facesitting face intheclub

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/W/4vcWp/Facesitting%20face%20intheclub_cover.jpg) (http://pimpandhost.com/image/66543261)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting face intheclub
Runtime : 19min 13s
File Size : 91.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/W/4vcWr/Facesitting%20face%20intheclub_thumb_0.jpg) (http://pimpandhost.com/image/66543263)

Download Links:

Facesitting face intheclub.rar (http://k2s.cc/file/ffad1fc4196dc)
Title: Facesitting face inthemorning
Post by: squidmanheis on August 26, 2017, 10:30:17 am
Facesitting face inthemorning

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/X/4vcXi/Facesitting%20face%20inthemorning_cover.jpg) (http://pimpandhost.com/image/66543316)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting face inthemorning
Runtime : 19min 13s
File Size : 91.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/X/4vcXk/Facesitting%20face%20inthemorning_thumb_0.jpg) (http://pimpandhost.com/image/66543318)

Download Links:

Facesitting face inthemorning.rar (http://k2s.cc/file/9a014c98ad2f5)
Title: Facesitting face masturbation
Post by: squidmanheis on August 26, 2017, 01:30:13 pm
Facesitting face masturbation

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/X/4vcXG/Facesitting%20face%20masturbation_cover.jpg) (http://pimpandhost.com/image/66543340)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting face masturbation
Runtime : 19min 11s
File Size : 91.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/X/4vcXJ/Facesitting%20face%20masturbation_thumb_0.jpg) (http://pimpandhost.com/image/66543343)

Download Links:

Facesitting face masturbation.rar (http://k2s.cc/file/c094fad6c0f81)
Title: Facesitting face masturbation2
Post by: squidmanheis on August 26, 2017, 04:30:11 pm
Facesitting face masturbation2

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/Y/4vcY7/Facesitting%20face%20masturbation2_cover.jpg) (http://pimpandhost.com/image/66543367)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting face masturbation2
Runtime : 19min 12s
File Size : 91.2 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/Y/4vcYa/Facesitting%20face%20masturbation2_thumb_0.jpg) (http://pimpandhost.com/image/66543370)

Download Links:

Facesitting face masturbation2.rar (http://k2s.cc/file/596d482c2b333)
Title: Facesitting face mummy
Post by: squidmanheis on August 26, 2017, 07:30:11 pm
Facesitting face mummy

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/Y/4vcYS/Facesitting%20face%20mummy_cover.jpg) (http://pimpandhost.com/image/66543414)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting face mummy
Runtime : 19min 18s
File Size : 92.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/Y/4vcYV/Facesitting%20face%20mummy_thumb_0.jpg) (http://pimpandhost.com/image/66543417)

Download Links:

Facesitting face mummy.rar (http://k2s.cc/file/77ec83bb50620)
Title: Facesitting face orgasm
Post by: squidmanheis on August 26, 2017, 10:30:32 pm
Facesitting face orgasm

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/Z/4vcZs/Facesitting%20face%20orgasm_cover.jpg) (http://pimpandhost.com/image/66543450)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting face orgasm
Runtime : 19min 27s
File Size : 91.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/c/Z/4vcZv/Facesitting%20face%20orgasm_thumb_0.jpg) (http://pimpandhost.com/image/66543453)

Download Links:

Facesitting face orgasm.rar (http://k2s.cc/file/3c7613b521913)
Title: Facesitting face punishment
Post by: squidmanheis on August 27, 2017, 01:30:32 am
Facesitting face punishment

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/1/4vd1j/Facesitting%20face%20punishment_cover.jpg) (http://pimpandhost.com/image/66543565)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting face punishment
Runtime : 19min 46s
File Size : 94.5 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/1/4vd1o/Facesitting%20face%20punishment_thumb_0.jpg) (http://pimpandhost.com/image/66543570)

Download Links:

Facesitting face punishment.rar (http://k2s.cc/file/862eb7fc9443a)
Title: Facesitting face riding
Post by: squidmanheis on August 27, 2017, 04:30:41 am
Facesitting face riding

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/2/4vd2n/Facesitting%20face%20riding_cover.jpg) (http://pimpandhost.com/image/66543631)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting face riding
Runtime : 19min 13s
File Size : 91.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/2/4vd2q/Facesitting%20face%20riding_thumb_0.jpg) (http://pimpandhost.com/image/66543634)

Download Links:

Facesitting face riding.rar (http://k2s.cc/file/73a27ccd1065c)
Title: Facesitting facefull ofass
Post by: squidmanheis on August 27, 2017, 07:30:28 am
Facesitting facefull ofass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/3/4vd3q/Facesitting%20facefull%20ofass_cover.jpg) (http://pimpandhost.com/image/66543696)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facefull ofass
Runtime : 18min 57s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/3/4vd3w/Facesitting%20facefull%20ofass_thumb_0.jpg) (http://pimpandhost.com/image/66543702)

Download Links:

Facesitting facefull ofass.rar (http://k2s.cc/file/7a20b671142d8)
Title: Facesitting facesitting africa
Post by: squidmanheis on August 27, 2017, 10:30:28 am
Facesitting facesitting africa

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/5/4vd5J/Facesitting%20facesitting%20africa_cover.jpg) (http://pimpandhost.com/image/66543839)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting africa
Runtime : 19min 41s
File Size : 94.0 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/5/4vd5P/Facesitting%20facesitting%20africa_thumb_0.jpg) (http://pimpandhost.com/image/66543845)

Download Links:

Facesitting facesitting africa.rar (http://k2s.cc/file/cac25baebf841)
Title: Facesitting facesitting army
Post by: squidmanheis on August 27, 2017, 01:30:24 pm
Facesitting facesitting army

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/6/4vd6C/Facesitting%20facesitting%20army_cover.jpg) (http://pimpandhost.com/image/66543894)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting army
Runtime : 22min 25s
File Size : 107 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/6/4vd6E/Facesitting%20facesitting%20army_thumb_0.jpg) (http://pimpandhost.com/image/66543896)

Download Links:

Facesitting facesitting army.rar (http://k2s.cc/file/42f48c9e2b899)
Title: Facesitting facesitting blonde
Post by: squidmanheis on August 27, 2017, 04:30:36 pm
Facesitting facesitting blonde

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/8/4vd84/Facesitting%20facesitting%20blonde_cover.jpg) (http://pimpandhost.com/image/66543984)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting blonde
Runtime : 12min 35s
File Size : 59.0 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/8/4vd86/Facesitting%20facesitting%20blonde_thumb_0.jpg) (http://pimpandhost.com/image/66543986)

Download Links:

Facesitting facesitting blonde.rar (http://k2s.cc/file/30babb0f49ddb)
Title: Facesitting facesitting dancer
Post by: squidmanheis on August 27, 2017, 07:30:25 pm
Facesitting facesitting dancer

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/8/4vd8U/Facesitting%20facesitting%20dancer_cover.jpg) (http://pimpandhost.com/image/66544036)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting dancer
Runtime : 19min 1s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/8/4vd8Z/Facesitting%20facesitting%20dancer_thumb_0.jpg) (http://pimpandhost.com/image/66544041)

Download Links:

Facesitting facesitting dancer.rar (http://k2s.cc/file/80213660526fd)
Title: Facesitting facesitting domination
Post by: squidmanheis on August 27, 2017, 10:30:27 pm
Facesitting facesitting domination

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/b/4vdbv/Facesitting%20facesitting%20domination_cover.jpg) (http://pimpandhost.com/image/66544197)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting domination
Runtime : 12min 28s
File Size : 58.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/b/4vdbB/Facesitting%20facesitting%20domination_thumb_0.jpg) (http://pimpandhost.com/image/66544203)

Download Links:

Facesitting facesitting domination.rar (http://k2s.cc/file/864680a220163)
Title: Facesitting facesitting fatal
Post by: squidmanheis on August 28, 2017, 01:30:26 am
Facesitting facesitting fatal

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/c/4vdcj/Facesitting%20facesitting%20fatal_cover.jpg) (http://pimpandhost.com/image/66544247)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting fatal
Runtime : 12min 48s
File Size : 59.9 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/c/4vdcl/Facesitting%20facesitting%20fatal_thumb_0.jpg) (http://pimpandhost.com/image/66544249)

Download Links:

Facesitting facesitting fatal.rar (http://k2s.cc/file/b4801e83f8701)
Title: Facesitting facesitting games
Post by: squidmanheis on August 28, 2017, 04:30:24 am
Facesitting facesitting games

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/d/4vddp/Facesitting%20facesitting%20games_cover.jpg) (http://pimpandhost.com/image/66544315)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting games
Runtime : 12min 53s
File Size : 60.3 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/d/4vddu/Facesitting%20facesitting%20games_thumb_0.jpg) (http://pimpandhost.com/image/66544320)

Download Links:

Facesitting facesitting games.rar (http://k2s.cc/file/55cf5572c0f1e)
Title: Facesitting facesitting gang
Post by: squidmanheis on August 28, 2017, 07:30:21 am
Facesitting facesitting gang

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/e/4vdeA/Facesitting%20facesitting%20gang_cover.jpg) (http://pimpandhost.com/image/66544388)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting gang
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/e/4vdeH/Facesitting%20facesitting%20gang_thumb_0.jpg) (http://pimpandhost.com/image/66544395)

Download Links:

Facesitting facesitting gang.rar (http://k2s.cc/file/e4b8b75d371d8)
Title: Facesitting facesitting giant
Post by: squidmanheis on August 28, 2017, 10:30:23 am
Facesitting facesitting giant

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/h/4vdhd/Facesitting%20facesitting%20giant_cover.jpg) (http://pimpandhost.com/image/66544551)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting giant
Runtime : 12min 54s
File Size : 60.9 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/h/4vdhi/Facesitting%20facesitting%20giant_thumb_0.jpg) (http://pimpandhost.com/image/66544556)

Download Links:

Facesitting facesitting giant.rar (http://k2s.cc/file/466ca78476f68)
Title: Facesitting facesitting humiliaton
Post by: squidmanheis on August 28, 2017, 01:30:21 pm
Facesitting facesitting humiliaton

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/h/4vdhT/Facesitting%20facesitting%20humiliaton_cover.jpg) (http://pimpandhost.com/image/66544593)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting humiliaton
Runtime : 18min 37s
File Size : 87.5 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/i/4vdi0/Facesitting%20facesitting%20humiliaton_thumb_0.jpg) (http://pimpandhost.com/image/66544600)

Download Links:

Facesitting facesitting humiliaton.rar (http://k2s.cc/file/f000d31be4b22)
Title: Facesitting facesitting pantyhose
Post by: squidmanheis on August 28, 2017, 04:30:18 pm
Facesitting facesitting pantyhose

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/i/4vdiX/Facesitting%20facesitting%20pantyhose_cover.jpg) (http://pimpandhost.com/image/66544659)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting pantyhose
Runtime : 16min 7s
File Size : 75.9 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/j/4vdj0/Facesitting%20facesitting%20pantyhose_thumb_0.jpg) (http://pimpandhost.com/image/66544662)

Download Links:

Facesitting facesitting pantyhose.rar (http://k2s.cc/file/346be3a76b808)
Title: Facesitting facesitting session
Post by: squidmanheis on August 28, 2017, 07:30:17 pm
Facesitting facesitting session

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/j/4vdjZ/Facesitting%20facesitting%20session_cover.jpg) (http://pimpandhost.com/image/66544723)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting facesitting session
Runtime : 19min 14s
File Size : 91.7 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/k/4vdk3/Facesitting%20facesitting%20session_thumb_0.jpg) (http://pimpandhost.com/image/66544727)

Download Links:

Facesitting facesitting session.rar (http://k2s.cc/file/3c3c03d1fe6e8)
Title: Facesitting fecesitting mulatto
Post by: squidmanheis on August 29, 2017, 10:30:08 am
Facesitting fecesitting mulatto

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/r/4vdrK/Facesitting%20fecesitting%20mulatto_cover.jpg) (http://pimpandhost.com/image/66545204)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fecesitting mulatto
Runtime : 12min 36s
File Size : 59.0 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/r/4vdrL/Facesitting%20fecesitting%20mulatto_thumb_0.jpg) (http://pimpandhost.com/image/66545205)

Download Links:

Facesitting fecesitting mulatto.rar (http://k2s.cc/file/f792b9e0f56c6)
Title: Facesitting feelanitas ass
Post by: squidmanheis on August 29, 2017, 01:30:07 pm
Facesitting feelanitas ass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/s/4vds1/Facesitting%20feelanitas%20ass_cover.jpg) (http://pimpandhost.com/image/66545221)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting feelanitas ass
Runtime : 18min 49s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/s/4vds3/Facesitting%20feelanitas%20ass_thumb_0.jpg) (http://pimpandhost.com/image/66545223)

Download Links:

Facesitting feelanitas ass.rar (http://k2s.cc/file/9135e1a33c35b)
Title: Facesitting feelflavias weigtt
Post by: squidmanheis on August 29, 2017, 04:30:07 pm
Facesitting feelflavias weigtt

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/s/4vdsq/Facesitting%20feelflavias%20weigtt_cover.jpg) (http://pimpandhost.com/image/66545246)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting feelflavias weigtt
Runtime : 18min 49s
File Size : 195 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/s/4vdsu/Facesitting%20feelflavias%20weigtt_thumb_0.jpg) (http://pimpandhost.com/image/66545250)

Download Links:

Facesitting feelflavias weigtt.rar (http://k2s.cc/file/ff56295995acd)
Title: Facesitting feelmy bigbutt
Post by: squidmanheis on August 29, 2017, 07:30:05 pm
Facesitting feelmy bigbutt

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/u/4vdu6/Facesitting%20feelmy%20bigbutt_cover.jpg) (http://pimpandhost.com/image/66545350)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting feelmy bigbutt
Runtime : 19min 12s
File Size : 91.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/u/4vdu9/Facesitting%20feelmy%20bigbutt_thumb_0.jpg) (http://pimpandhost.com/image/66545353)

Download Links:

Facesitting feelmy bigbutt.rar (http://k2s.cc/file/2acb50e6e0669)
Title: Facesitting feelmy face
Post by: squidmanheis on August 29, 2017, 10:30:02 pm
Facesitting feelmy face

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/u/4vdup/Facesitting%20feelmy%20face_cover.jpg) (http://pimpandhost.com/image/66545369)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting feelmy face
Runtime : 18min 49s
File Size : 197 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/u/4vduq/Facesitting%20feelmy%20face_thumb_0.jpg) (http://pimpandhost.com/image/66545370)

Download Links:

Facesitting feelmy face.rar (http://k2s.cc/file/13b561f4ecea3)
Title: Facesitting feelmydirtyass bitch
Post by: squidmanheis on August 30, 2017, 01:30:03 am
Facesitting feelmydirtyass bitch

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/v/4vdv2/Facesitting%20feelmydirtyass%20bitch_cover.jpg) (http://pimpandhost.com/image/66545408)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting feelmydirtyass bitch
Runtime : 19min 13s
File Size : 91.7 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/v/4vdv4/Facesitting%20feelmydirtyass%20bitch_thumb_0.jpg) (http://pimpandhost.com/image/66545410)

Download Links:

Facesitting feelmydirtyass bitch.rar (http://k2s.cc/file/220f2c3d3c2c4)
Title: Facesitting feelour blackasses
Post by: squidmanheis on August 30, 2017, 04:30:01 am
Facesitting feelour blackasses

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/v/4vdvs/Facesitting%20feelour%20blackasses_cover.jpg) (http://pimpandhost.com/image/66545434)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting feelour blackasses
Runtime : 19min 13s
File Size : 91.2 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/v/4vdvt/Facesitting%20feelour%20blackasses_thumb_0.jpg) (http://pimpandhost.com/image/66545435)

Download Links:

Facesitting feelour blackasses.rar (http://k2s.cc/file/2eef7280d3797)
Title: Facesitting feelour weight
Post by: squidmanheis on August 30, 2017, 07:29:58 am
Facesitting feelour weight

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/w/4vdwc/Facesitting%20feelour%20weight_cover.jpg) (http://pimpandhost.com/image/66545480)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting feelour weight
Runtime : 19min 13s
File Size : 91.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/w/4vdwd/Facesitting%20feelour%20weight_thumb_0.jpg) (http://pimpandhost.com/image/66545481)

Download Links:

Facesitting feelour weight.rar (http://k2s.cc/file/3d653707b71dd)
Title: Facesitting fellbig breasty
Post by: squidmanheis on August 30, 2017, 10:29:59 am
Facesitting fellbig breasty

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/x/4vdx5/Facesitting%20fellbig%20breasty_cover.jpg) (http://pimpandhost.com/image/66545535)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fellbig breasty
Runtime : 19min 13s
File Size : 92.2 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/x/4vdxc/Facesitting%20fellbig%20breasty_thumb_0.jpg) (http://pimpandhost.com/image/66545542)

Download Links:

Facesitting fellbig breasty.rar (http://k2s.cc/file/5ce087fbcc71f)
Title: Facesitting firsttime ofnicole
Post by: squidmanheis on August 30, 2017, 01:29:57 pm
Facesitting firsttime ofnicole

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/x/4vdxy/Facesitting%20firsttime%20ofnicole_cover.jpg) (http://pimpandhost.com/image/66545564)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting firsttime ofnicole
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/x/4vdxz/Facesitting%20firsttime%20ofnicole_thumb_0.jpg) (http://pimpandhost.com/image/66545565)

Download Links:

Facesitting firsttime ofnicole.rar (http://k2s.cc/file/37a518898102b)
Title: Facesitting force hands
Post by: squidmanheis on August 30, 2017, 04:29:59 pm
Facesitting force hands

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/y/4vdyw/Facesitting%20force%20hands_cover.jpg) (http://pimpandhost.com/image/66545624)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting force hands
Runtime : 10min 23s
File Size : 48.9 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/y/4vdyz/Facesitting%20force%20hands_thumb_0.jpg) (http://pimpandhost.com/image/66545627)

Download Links:

Facesitting force hands.rar (http://k2s.cc/file/1e6f6b946ede1)
Title: Facesitting forced face lesbian
Post by: squidmanheis on August 30, 2017, 07:29:52 pm
Facesitting forced face lesbian

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/y/4vdyJ/Facesitting%20forced%20face%20lesbian_cover.jpg) (http://pimpandhost.com/image/66545637)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting forced face lesbian
Runtime : 22min 25s
File Size : 107 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/y/4vdyK/Facesitting%20forced%20face%20lesbian_thumb_0.jpg) (http://pimpandhost.com/image/66545638)

Download Links:

Facesitting forced face lesbian.rar (http://k2s.cc/file/fa8af16639dd5)
Title: Facesitting formy pleasure
Post by: squidmanheis on August 30, 2017, 10:29:52 pm
Facesitting formy pleasure

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/y/4vdyU/Facesitting%20formy%20pleasure_cover.jpg) (http://pimpandhost.com/image/66545648)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting formy pleasure
Runtime : 18min 55s
File Size : 197 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/y/4vdyX/Facesitting%20formy%20pleasure_thumb_0.jpg) (http://pimpandhost.com/image/66545651)

Download Links:

Facesitting formy pleasure.rar (http://k2s.cc/file/50826cab4c7eb)
Title: Facesitting fullweight facesitting
Post by: squidmanheis on August 31, 2017, 01:29:52 am
Facesitting fullweight facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/z/4vdzx/Facesitting%20fullweight%20facesitting_cover.jpg) (http://pimpandhost.com/image/66545687)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting fullweight facesitting
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/z/4vdzy/Facesitting%20fullweight%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66545688)

Download Links:

Facesitting fullweight facesitting.rar (http://k2s.cc/file/b8ba2644064e6)
Title: Facesitting furious facesitting
Post by: squidmanheis on August 31, 2017, 04:29:46 am
Facesitting furious facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/A/4vdA0/Facesitting%20furious%20facesitting_cover.jpg) (http://pimpandhost.com/image/66545716)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting furious facesitting
Runtime : 19min 29s
File Size : 199 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/A/4vdA1/Facesitting%20furious%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66545717)

Download Links:

Facesitting furious facesitting.rar (http://k2s.cc/file/2bafb82823e39)
Title: Facesitting gothic facesitting
Post by: squidmanheis on August 31, 2017, 07:29:46 am
Facesitting gothic facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/B/4vdBa/Facesitting%20gothic%20facesitting_cover.jpg) (http://pimpandhost.com/image/66545788)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting gothic facesitting
Runtime : 19min 1s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/B/4vdBb/Facesitting%20gothic%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66545789)

Download Links:

Facesitting gothic facesitting.rar (http://k2s.cc/file/797946f88ab18)
Title: Facesitting hands humiliation
Post by: squidmanheis on August 31, 2017, 10:29:44 am
Facesitting hands humiliation

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/B/4vdBF/Facesitting%20hands%20humiliation_cover.jpg) (http://pimpandhost.com/image/66545819)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting hands humiliation
Runtime : 19min 57s
File Size : 95.1 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/B/4vdBG/Facesitting%20hands%20humiliation_thumb_0.jpg) (http://pimpandhost.com/image/66545820)

Download Links:

Facesitting hands humiliation.rar (http://k2s.cc/file/cd1806ef58b04)
Title: Facesitting hands mulatto
Post by: squidmanheis on August 31, 2017, 01:29:45 pm
Facesitting hands mulatto

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/C/4vdCa/Facesitting%20hands%20mulatto_cover.jpg) (http://pimpandhost.com/image/66545850)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting hands mulatto
Runtime : 19min 16s
File Size : 91.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/C/4vdCb/Facesitting%20hands%20mulatto_thumb_0.jpg) (http://pimpandhost.com/image/66545851)

Download Links:

Facesitting hands mulatto.rar (http://k2s.cc/file/447642acb3a17)
Title: Facesitting handsmother extreme
Post by: squidmanheis on August 31, 2017, 04:30:19 pm
Facesitting handsmother extreme

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/C/4vdCy/Facesitting%20handsmother%20extreme_cover.jpg) (http://pimpandhost.com/image/66545874)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting handsmother extreme
Runtime : 19min 12s
File Size : 91.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/C/4vdCz/Facesitting%20handsmother%20extreme_thumb_0.jpg) (http://pimpandhost.com/image/66545875)

Download Links:

Facesitting handsmother extreme.rar (http://k2s.cc/file/1782ea984e0e0)
Title: Facesitting hard facesitting
Post by: squidmanheis on August 31, 2017, 07:30:18 pm
Facesitting hard facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/C/4vdCQ/Facesitting%20hard%20facesitting_cover.jpg) (http://pimpandhost.com/image/66545892)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting hard facesitting
Runtime : 19min 13s
File Size : 91.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/C/4vdCR/Facesitting%20hard%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66545893)

Download Links:

Facesitting hard facesitting.rar (http://k2s.cc/file/41404043209d0)
Title: Facesitting heavy facesitting
Post by: squidmanheis on August 31, 2017, 10:30:17 pm
Facesitting heavy facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/D/4vdD6/Facesitting%20heavy%20facesitting_cover.jpg) (http://pimpandhost.com/image/66545908)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting heavy facesitting
Runtime : 13min 38s
File Size : 64.1 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/D/4vdD7/Facesitting%20heavy%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66545909)

Download Links:

Facesitting heavy facesitting.rar (http://k2s.cc/file/e80784f884d7a)
Title: Facesitting heavy lesson
Post by: squidmanheis on September 01, 2017, 01:30:24 am
Facesitting heavy lesson

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/D/4vdDi/Facesitting%20heavy%20lesson_cover.jpg) (http://pimpandhost.com/image/66545920)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting heavy lesson
Runtime : 19min 26s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/D/4vdDk/Facesitting%20heavy%20lesson_thumb_0.jpg) (http://pimpandhost.com/image/66545922)

Download Links:

Facesitting heavy lesson.rar (http://k2s.cc/file/d4cc62ae967c8)
Title: Facesitting hour smothering
Post by: squidmanheis on September 01, 2017, 04:30:11 am
Facesitting hour smothering

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/D/4vdDF/Facesitting%20hour%20smothering_cover.jpg) (http://pimpandhost.com/image/66545943)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting hour smothering
Runtime : 18min 49s
File Size : 199 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/D/4vdDG/Facesitting%20hour%20smothering_thumb_0.jpg) (http://pimpandhost.com/image/66545944)

Download Links:

Facesitting hour smothering.rar (http://k2s.cc/file/595ea09d183c0)
Title: Facesitting howto smother
Post by: squidmanheis on September 01, 2017, 07:30:10 am
Facesitting howto smother

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/E/4vdEa/Facesitting%20howto%20smother_cover.jpg) (http://pimpandhost.com/image/66545974)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting howto smother
Runtime : 19min 1s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/E/4vdEb/Facesitting%20howto%20smother_thumb_0.jpg) (http://pimpandhost.com/image/66545975)

Download Links:

Facesitting howto smother.rar (http://k2s.cc/file/f8387a4a139bb)
Title: Facesitting iamwinner
Post by: squidmanheis on September 01, 2017, 10:30:11 am
Facesitting iamwinner

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/E/4vdEE/Facesitting%20iamwinner_cover.jpg) (http://pimpandhost.com/image/66546004)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting iamwinner
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/E/4vdEF/Facesitting%20iamwinner_thumb_0.jpg) (http://pimpandhost.com/image/66546005)

Download Links:

Facesitting iamwinner.rar (http://k2s.cc/file/4669882fc473c)
Title: Facesitting im back
Post by: squidmanheis on September 01, 2017, 01:30:06 pm
Facesitting im back

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/F/4vdF4/Facesitting%20im%20back_cover.jpg) (http://pimpandhost.com/image/66546030)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting im back
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/F/4vdF6/Facesitting%20im%20back_thumb_0.jpg) (http://pimpandhost.com/image/66546032)

Download Links:

Facesitting im back.rar (http://k2s.cc/file/ba02db9c779bd)
Title: Facesitting imyour bossnow
Post by: squidmanheis on September 01, 2017, 04:30:07 pm
Facesitting imyour bossnow

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/F/4vdFA/Facesitting%20imyour%20bossnow_cover.jpg) (http://pimpandhost.com/image/66546062)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting imyour bossnow
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/F/4vdFC/Facesitting%20imyour%20bossnow_thumb_0.jpg) (http://pimpandhost.com/image/66546064)

Download Links:

Facesitting imyour bossnow.rar (http://k2s.cc/file/59d5e42d0bec4)
Title: Facesitting in control
Post by: squidmanheis on September 01, 2017, 07:30:05 pm
Facesitting in control

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/F/4vdFZ/Facesitting%20in%20control_cover.jpg) (http://pimpandhost.com/image/66546087)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting in control
Runtime : 19min 13s
File Size : 197 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/G/4vdG0/Facesitting%20in%20control_thumb_0.jpg) (http://pimpandhost.com/image/66546088)

Download Links:

Facesitting in control.rar (http://k2s.cc/file/709ff26577932)
Title: Facesitting intense facesitting
Post by: squidmanheis on September 01, 2017, 10:30:05 pm
Facesitting intense facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/H/4vdHt/Facesitting%20intense%20facesitting_cover.jpg) (http://pimpandhost.com/image/66546179)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting intense facesitting
Runtime : 19min 13s
File Size : 199 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/H/4vdHv/Facesitting%20intense%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66546181)

Download Links:

Facesitting intense facesitting.rar (http://k2s.cc/file/dedd5ccec192f)
Title: Facesitting iwat tofeelyour
Post by: squidmanheis on September 02, 2017, 01:30:02 am
Facesitting iwat tofeelyour

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/I/4vdIX/Facesitting%20iwat%20tofeelyour_cover.jpg) (http://pimpandhost.com/image/66546271)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting iwat tofeelyour
Runtime : 19min 1s
File Size : 198 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/I/4vdIZ/Facesitting%20iwat%20tofeelyour_thumb_0.jpg) (http://pimpandhost.com/image/66546273)

Download Links:

Facesitting iwat tofeelyour.rar (http://k2s.cc/file/ffcbef87f8ffa)
Title: Facesitting juliana again
Post by: squidmanheis on September 02, 2017, 04:30:01 am
Facesitting juliana again

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/J/4vdJt/Facesitting%20juliana%20again_cover.jpg) (http://pimpandhost.com/image/66546303)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting juliana again
Runtime : 19min 23s
File Size : 197 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/J/4vdJu/Facesitting%20juliana%20again_thumb_0.jpg) (http://pimpandhost.com/image/66546304)

Download Links:

Facesitting juliana again.rar (http://k2s.cc/file/037220e73f579)
Title: Facesitting karines sweatybutt
Post by: squidmanheis on September 02, 2017, 07:29:58 am
Facesitting karines sweatybutt

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/K/4vdKG/Facesitting%20karines%20sweatybutt_cover.jpg) (http://pimpandhost.com/image/66546378)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting karines sweatybutt
Runtime : 19min 13s
File Size : 91.7 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/K/4vdKH/Facesitting%20karines%20sweatybutt_thumb_0.jpg) (http://pimpandhost.com/image/66546379)

Download Links:

Facesitting karines sweatybutt.rar (http://k2s.cc/file/04f577cc8a1cc)
Title: Facesitting kellysreturn
Post by: squidmanheis on September 02, 2017, 10:29:57 am
Facesitting kellysreturn

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/K/4vdKV/Facesitting%20kellysreturn_cover.jpg) (http://pimpandhost.com/image/66546393)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting kellysreturn
Runtime : 19min 1s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/K/4vdKW/Facesitting%20kellysreturn_thumb_0.jpg) (http://pimpandhost.com/image/66546394)

Download Links:

Facesitting kellysreturn.rar (http://k2s.cc/file/35cfb2a44efb6)
Title: Facesitting laurens seat
Post by: squidmanheis on September 02, 2017, 01:29:56 pm
Facesitting laurens seat

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/L/4vdLm/Facesitting%20laurens%20seat_cover.jpg) (http://pimpandhost.com/image/66546420)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting laurens seat
Runtime : 19min 13s
File Size : 200 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/L/4vdLq/Facesitting%20laurens%20seat_thumb_0.jpg) (http://pimpandhost.com/image/66546424)

Download Links:

Facesitting laurens seat.rar (http://k2s.cc/file/fa75e64f39e2c)
Title: Facesitting lesson for robert
Post by: squidmanheis on September 02, 2017, 04:29:55 pm
Facesitting lesson for robert

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/L/4vdLT/Facesitting%20lesson%20for%20robert_cover.jpg) (http://pimpandhost.com/image/66546453)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting lesson for robert
Runtime : 12min 50s
File Size : 60.2 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/L/4vdLU/Facesitting%20lesson%20for%20robert_thumb_0.jpg) (http://pimpandhost.com/image/66546454)

Download Links:

Facesitting lesson for robert.rar (http://k2s.cc/file/ecb4e2c1e657c)
Title: Facesitting letme breathe
Post by: squidmanheis on September 02, 2017, 07:29:54 pm
Facesitting letme breathe

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/M/4vdM1/Facesitting%20letme%20breathe_cover.jpg) (http://pimpandhost.com/image/66546461)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting letme breathe
Runtime : 19min 13s
File Size : 197 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/M/4vdM2/Facesitting%20letme%20breathe_thumb_0.jpg) (http://pimpandhost.com/image/66546462)

Download Links:

Facesitting letme breathe.rar (http://k2s.cc/file/261b0f222d381)
Title: Facesitting lick ass
Post by: squidmanheis on September 02, 2017, 10:29:58 pm
Facesitting lick ass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/M/4vdMC/Facesitting%20lick%20ass_cover.jpg) (http://pimpandhost.com/image/66546498)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting lick ass
Runtime : 13min 0s
File Size : 61.1 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/M/4vdMD/Facesitting%20lick%20ass_thumb_0.jpg) (http://pimpandhost.com/image/66546499)

Download Links:

Facesitting lick ass.rar (http://k2s.cc/file/3fa551f773195)
Title: Facesitting littlenose sqeezingbutt
Post by: squidmanheis on September 03, 2017, 01:29:56 am
Facesitting littlenose sqeezingbutt

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/M/4vdMM/Facesitting%20littlenose%20sqeezingbutt_cover.jpg) (http://pimpandhost.com/image/66546508)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting littlenose sqeezingbutt
Runtime : 19min 13s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/M/4vdMN/Facesitting%20littlenose%20sqeezingbutt_thumb_0.jpg) (http://pimpandhost.com/image/66546509)

Download Links:

Facesitting littlenose sqeezingbutt.rar (http://k2s.cc/file/57f5e4ac8ade9)
Title: Facesitting lovemybutt
Post by: squidmanheis on September 03, 2017, 04:29:56 am
Facesitting lovemybutt

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/N/4vdNa/Facesitting%20lovemybutt_cover.jpg) (http://pimpandhost.com/image/66546532)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting lovemybutt
Runtime : 19min 27s
File Size : 91.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/N/4vdNb/Facesitting%20lovemybutt_thumb_0.jpg) (http://pimpandhost.com/image/66546533)

Download Links:

Facesitting lovemybutt.rar (http://k2s.cc/file/8670489c95cb4)
Title: Facesitting mature facesitting
Post by: squidmanheis on September 03, 2017, 07:29:53 am
Facesitting mature facesitting

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/N/4vdNo/Facesitting%20mature%20facesitting_cover.jpg) (http://pimpandhost.com/image/66546546)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting mature facesitting
Runtime : 19min 13s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/N/4vdNp/Facesitting%20mature%20facesitting_thumb_0.jpg) (http://pimpandhost.com/image/66546547)

Download Links:

Facesitting mature facesitting.rar (http://k2s.cc/file/1a02417472daf)
Title: Facesitting maybeyoubreathe
Post by: squidmanheis on September 03, 2017, 10:41:25 am
Facesitting maybeyoubreathe

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/O/4vdO7/Facesitting%20maybeyoubreathe_cover.jpg) (http://pimpandhost.com/image/66546591)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting maybeyoubreathe
Runtime : 19min 13s
File Size : 200 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/O/4vdOa/Facesitting%20maybeyoubreathe_thumb_0.jpg) (http://pimpandhost.com/image/66546594)

Download Links:

Facesitting maybeyoubreathe.rar (http://k2s.cc/file/7cd6b0cdd3e9d)
Title: Facesitting meetmynewgoddess
Post by: squidmanheis on September 03, 2017, 01:29:48 pm
Facesitting meetmynewgoddess

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/O/4vdOU/Facesitting%20meetmynewgoddess_cover.jpg) (http://pimpandhost.com/image/66546640)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting meetmynewgoddess
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/O/4vdOW/Facesitting%20meetmynewgoddess_thumb_0.jpg) (http://pimpandhost.com/image/66546642)

Download Links:

Facesitting meetmynewgoddess.rar (http://k2s.cc/file/25fce34f5bb8c)
Title: Facesitting melissa mychair
Post by: squidmanheis on September 03, 2017, 04:29:50 pm
Facesitting melissa mychair

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/P/4vdPl/Facesitting%20melissa%20mychair_cover.jpg) (http://pimpandhost.com/image/66546667)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting melissa mychair
Runtime : 19min 13s
File Size : 91.5 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/P/4vdPo/Facesitting%20melissa%20mychair_thumb_0.jpg) (http://pimpandhost.com/image/66546670)

Download Links:

Facesitting melissa mychair.rar (http://k2s.cc/file/981f83a7fb492)
Title: Facesitting melissa ontop
Post by: squidmanheis on September 03, 2017, 07:29:51 pm
Facesitting melissa ontop

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/P/4vdPB/Facesitting%20melissa%20ontop_cover.jpg) (http://pimpandhost.com/image/66546683)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting melissa ontop
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/P/4vdPC/Facesitting%20melissa%20ontop_thumb_0.jpg) (http://pimpandhost.com/image/66546684)

Download Links:

Facesitting melissa ontop.rar (http://k2s.cc/file/37de2c0c63e82)
Title: Facesitting michele again
Post by: squidmanheis on September 03, 2017, 10:29:53 pm
Facesitting michele again

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/Q/4vdQv/Facesitting%20michele%20again_cover.jpg) (http://pimpandhost.com/image/66546739)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting michele again
Runtime : 19min 25s
File Size : 197 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/Q/4vdQy/Facesitting%20michele%20again_thumb_0.jpg) (http://pimpandhost.com/image/66546742)

Download Links:

Facesitting michele again.rar (http://k2s.cc/file/e4388fa0ec653)
Title: Facesitting milly return
Post by: squidmanheis on September 04, 2017, 01:29:50 am
Facesitting milly return

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/R/4vdR6/Facesitting%20milly%20return_cover.jpg) (http://pimpandhost.com/image/66546776)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting milly return
Runtime : 19min 1s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/R/4vdR7/Facesitting%20milly%20return_thumb_0.jpg) (http://pimpandhost.com/image/66546777)

Download Links:

Facesitting milly return.rar (http://k2s.cc/file/9b3a94671912a)
Title: Facesitting millys fury
Post by: squidmanheis on September 04, 2017, 04:29:51 am
Facesitting millys fury

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/T/4vdTq/Facesitting%20millys%20fury_cover.jpg) (http://pimpandhost.com/image/66546920)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting millys fury
Runtime : 19min 37s
File Size : 203 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/T/4vdTr/Facesitting%20millys%20fury_thumb_0.jpg) (http://pimpandhost.com/image/66546921)

Download Links:

Facesitting millys fury.rar (http://k2s.cc/file/2360662f306d9)
Title: Facesitting mistress cris
Post by: squidmanheis on September 04, 2017, 07:29:50 am
Facesitting mistress cris

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/U/4vdUm/Facesitting%20mistress%20cris_cover.jpg) (http://pimpandhost.com/image/66546978)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting mistress cris
Runtime : 19min 13s
File Size : 91.4 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/U/4vdUn/Facesitting%20mistress%20cris_thumb_0.jpg) (http://pimpandhost.com/image/66546979)

Download Links:

Facesitting mistress cris.rar (http://k2s.cc/file/4be5f08c220d4)
Title: Facesitting mistress rule
Post by: squidmanheis on September 04, 2017, 10:29:40 am
Facesitting mistress rule

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/U/4vdUB/Facesitting%20mistress%20rule_cover.jpg) (http://pimpandhost.com/image/66546993)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting mistress rule
Runtime : 19min 13s
File Size : 91.8 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/U/4vdUD/Facesitting%20mistress%20rule_thumb_0.jpg) (http://pimpandhost.com/image/66546995)

Download Links:

Facesitting mistress rule.rar (http://k2s.cc/file/08d4e8b4b06d7)
Title: Facesitting mistressdelicious blackass
Post by: squidmanheis on September 04, 2017, 01:29:45 pm
Facesitting mistressdelicious blackass

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/W/4vdW8/Facesitting%20mistressdelicious%20blackass_cover.jpg) (http://pimpandhost.com/image/66547088)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting mistressdelicious blackass
Runtime : 19min 12s
File Size : 91.6 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/W/4vdWa/Facesitting%20mistressdelicious%20blackass_thumb_0.jpg) (http://pimpandhost.com/image/66547090)

Download Links:

Facesitting mistressdelicious blackass.rar (http://k2s.cc/file/d8257c3494086)
Title: Facesitting monaliza lesson
Post by: squidmanheis on September 04, 2017, 04:29:44 pm
Facesitting monaliza lesson

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/W/4vdWx/Facesitting%20monaliza%20lesson_cover.jpg) (http://pimpandhost.com/image/66547113)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting monaliza lesson
Runtime : 19min 13s
File Size : 202 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/W/4vdWz/Facesitting%20monaliza%20lesson_thumb_0.jpg) (http://pimpandhost.com/image/66547115)

Download Links:

Facesitting monaliza lesson.rar (http://k2s.cc/file/4f9f4909a5973)
Title: Facesitting mulattoqueen face
Post by: squidmanheis on September 04, 2017, 07:29:42 pm
Facesitting mulattoqueen face

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/Y/4vdYa/Facesitting%20mulattoqueen%20face_cover.jpg) (http://pimpandhost.com/image/66547214)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting mulattoqueen face
Runtime : 16min 0s
File Size : 76.1 MB
File Type: wmv
Resolution : 320x240

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/d/Y/4vdYc/Facesitting%20mulattoqueen%20face_thumb_0.jpg) (http://pimpandhost.com/image/66547216)

Download Links:

Facesitting mulattoqueen face.rar (http://k2s.cc/file/6bb8e55807fd8)
Title: Facesitting my new style
Post by: squidmanheis on September 04, 2017, 10:29:43 pm
Facesitting my new style

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/e/4/4ve4Y/Facesitting%20my%20new%20style_cover.jpg) (http://pimpandhost.com/image/66547636)

Tags: Femdom, Facesitting, Smothering ...

File Name : Facesitting my new style
Runtime : 19min 22s
File Size : 196 MB
File Type: wmv
Resolution : 640x480

(http://ist3-6.filesor.com/pimpandhost.com/1/2/4/5/124593/4/v/e/5/4ve54/Facesitting%20my%20new%20style_thumb_0.jpg) (http://pimpandhost.com/image/66547642)
